SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cassava4.1_005183m|PACid:17971404 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_005183m|PACid:17971404
Domain Number 1 Region: 6-148
Classification Level Classification E-value
Superfamily Cap-Gly domain 5.76e-35
Family Cap-Gly domain 0.00063
Further Details:      
 
Domain Number 2 Region: 125-389
Classification Level Classification E-value
Superfamily L domain-like 3.74e-25
Family Internalin LRR domain 0.0093
Further Details:      
 
Domain Number 3 Region: 447-534
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000341
Family Ubiquitin-related 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_005183m|PACid:17971404
Sequence length 537
Sequence
MQESTESSPDSFKLGQRVHSANDPSRIGTVKYVGPVQGYPGTWVGVDWDNGEGKHDGSVN
GVRYFQAKSERSGSFVRTQNLSPGISFLEALHIRYKGESTKEEEDEMYVLSASNKRVSVE
FVGKEKIQDKLSRFEELKGASLPYMGVSTPGNPSDISSLVPNLKELDLTGNLISEWKDVG
AMCEQLPGLTALNLSHNLMSQNITGLLQLKNIRVLVLNNTGIKWTQVEELNHLLPVIEEL
HLMGNGISTIKSTSSSIVQEFGSLRLLNLEDNSITEWNEILKLSLLRSLEQLHLNKNSLK
HIFYPDTDTMQNLLTGSESNVQMPFQNLRCLLLGGNNIEDLASIDSLNAFPKLVDIRLSE
NPIADTGRGGIPRFVLIARLSKVEILNGSEVSRRERKDSEIRYVRLVMSKLHDNPDEIKE
HPRFAELKAYHGIEDERPSVATSGPQKMASGLLSVNLKCVAASIGEKPLLTKKLPATTTV
GKLKILCESFFKLKSIKPKLFLQEEGSPLPSLLDDEMATLMDVGIGNESTILIDEES
Download sequence
Identical sequences A0A2C9U4A5
cassava4.1_005183m|PACid:17971404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]