SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cassava4.1_007624m|PACid:17976650 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_007624m|PACid:17976650
Domain Number 1 Region: 305-425
Classification Level Classification E-value
Superfamily PH domain-like 2.28e-30
Family Ran-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_007624m|PACid:17976650
Sequence length 447
Sequence
MGDAEHALPPSKKRAAGREISRDNPGLDDDEDSAEQETGTFKRASDEVLASRRILKVRRN
QPSSTPSSNPFAGIQLVPPTKPTTAPAVTTTEIVTASEKVSDGKTDACEETEKGKDETGN
KSESKVEEPVAETAAKEEIVEDKENNNVVNEATVPKVDSEKPAEGDKSENEKAAVGEEIE
NKKSAESDKTEKEKDNGKSENEEKENGSEKVDPSSESTHLSSFQQLSSSQNAFTGLAGTG
FSTSTFTFGSVPKDGSALGTSTGSLFGQKNDQPSFGFGLSNNGSSSIFNTTGPPIVSKNE
GTGFPSMQEVPVETGEENEKVVFSADSVLFEYFNGAWKERGKGELKVNVSTAGTERARLL
MRARGNYRLILNASLYPDMKLTNMDKRGVTFACMNSTGENKEGLSTFALKFKDGSIVEEF
RAAVAANKGKSAMNLKTPENSPKASDE
Download sequence
Identical sequences cassava4.1_007624m|PACid:17976650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]