SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cassava4.1_009693m|PACid:17968154 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_009693m|PACid:17968154
Domain Number 1 Region: 243-376
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.16e-33
Family Thioltransferase 0.0003
Further Details:      
 
Domain Number 2 Region: 104-215
Classification Level Classification E-value
Superfamily TPR-like 4.47e-23
Family Tetratricopeptide repeat (TPR) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_009693m|PACid:17968154
Sequence length 380
Sequence
MDAAKIADLRHFVDHCKSNPSILHDPSLAFFRTYLHSLGARIPPQTKSEEGDIDMSYSKE
DFNDQKSREEGDNIIESDIELDDSDIVEPDNDPPQKMGNPAIEVTEEKQDAAQTEKLKAM
DAISEGKLSEAIDHLTEAIMMNPTSAILYATRASVFVKVKKPNAAIRDANAALEINPDSA
KGYKIRGIARAMLGQWEEAAGDLHVASKLDYDEEIGLVLKKVEPNAHKIQEHRRKYERLR
KEKELKKVERERQQRAGAQGREALSALNDGQVIGIHSVSELETKLNAASKTSRLAILYFT
ATWCGPCRFISPVFTSLATKYPKTVFLKVDIDEARDVAAKWNISSVPTFFFIKNGKQVDK
VVGADKNGLERKIEQYASYA
Download sequence
Identical sequences A0A2C9VP08
cassava4.1_009693m|PACid:17968154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]