SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cassava4.1_012954m|PACid:17979910 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_012954m|PACid:17979910
Domain Number 1 Region: 158-239
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000468
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 2 Region: 260-290
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000706
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 98-130
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000877
Family CCCH zinc finger 0.0025
Further Details:      
 
Domain Number 4 Region: 35-60
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000706
Family CCCH zinc finger 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_012954m|PACid:17979910
Sequence length 294
Sequence
MDLRKRGRPEAGFNANGGFKKSKHEMDSLSTGVGSKSKPCTKFFSTAGCPFGESCHFLHY
VPGGYNAVAQMMNLGPAVTPVSRNMAAAPAVSNGSAPPAVKSRMCNKYNSAEGCKFGDKC
HFAHGEWELGRPIAPSHEDPRAIGALPGRMGGRMEPPSPGLAAGFGASATAKISVEASLA
GAIIGKGGVNSKQICRQTGAKLSIREHETDPNLRNIEFEGSFEQIKQASAMVSDLIASVS
AANAPAKSIGVAGGGHAGSNFKTKICENFSKGSCSFGQRCHFAHGAAELRKSGM
Download sequence
Identical sequences A0A2C9V903
cassava4.1_012954m|PACid:17979910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]