SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cassava4.1_014993m|PACid:17980538 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_014993m|PACid:17980538
Domain Number 1 Region: 113-231
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000955
Family Pleckstrin-homology domain (PH domain) 0.036
Further Details:      
 
Weak hits

Sequence:  cassava4.1_014993m|PACid:17980538
Domain Number - Region: 41-101
Classification Level Classification E-value
Superfamily Multimerization domain of the phosphoprotein from sendai virus 0.0144
Family Multimerization domain of the phosphoprotein from sendai virus 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_014993m|PACid:17980538
Sequence length 241
Sequence
MDDGLGKIKIVPDHFQVSTASENAPQRHNTPNLQPRIDNSARSGSRFWARRQLKRSAFML
NIFSLRGLPWSSSSEDQQKVELTVAELESLRSELADIEEREAHLKAQLEHVDEILRSARF
SGYLYIRTRWTALPGEPPPIDDTDVDDWLPRFVVLHGPCIFYYLLCTDLSPQDSTLLSDI
VEVGSLPSFTREDDETRYSFYILTRHGLRYECSSISKIQVDAWLAALKTECKSGSDALSE
I
Download sequence
Identical sequences A0A2C9WJ89
cassava4.1_014993m|PACid:17980538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]