SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cassava4.1_017577m|PACid:17980539 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_017577m|PACid:17980539
Domain Number 1 Region: 45-163
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000361
Family Pleckstrin-homology domain (PH domain) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_017577m|PACid:17980539
Sequence length 173
Sequence
MKNQGFYFIFYSLPFPLLVIFNFKKQAIQYVLFLVIVYRLEHVDEILRSARFSGYLYIRT
RWTALPGEPPPIDDTDVDDWLPRFVVLHGPCIFYYLLCTDLSPQDSTLLSDIVEVGSLPS
FTREDDETRYSFYILTRHGLRYECSSISKIQVDAWLAALKTECKSGSDALSEI
Download sequence
Identical sequences A0A2C9WHU7
cassava4.1_017577m|PACid:17980539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]