SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cassava4.1_025291m|PACid:17993773 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_025291m|PACid:17993773
Domain Number 1 Region: 281-387
Classification Level Classification E-value
Superfamily PH domain-like 0.0000196
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_025291m|PACid:17993773
Sequence length 403
Sequence
IRSCTEHQRAEESEPSRNSTLRMSSSSTTSLLQKLENTDENDPALWQPAYDAPETSVESM
EFLARSGFSAQAAKETVSSSSSSSIQQLFQQLPSGRSGCPPISPKDSEEMKLYKSIVKGR
TMGRWLKDQKERKKQEIRIHNAQLHAAVSVAGVAAAVAALAASNVMSEEIASSCHKIHSK
KPAAMASAAALVASYCIEIAEEIGADREQIIMVVNSALNARTNADIITLTAGAATALLGA
STLRARLQKGHGSTAFALVEEKGEEGKESNILAALNFVAGGGELLKLTRKGDLHWKQVSF
NINSNWQVVAKMKSKHMAGTFTKKKKCVVSGVYRDIPAWPRRDKEDCNEERVYFGIKTAE
RLVEFECRSRNEKQMWTEGIRHLLNCCTNIKSEATFNYCKTSL
Download sequence
Identical sequences cassava4.1_025291m|PACid:17993773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]