SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cassava4.1_028147m|PACid:17961604 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_028147m|PACid:17961604
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily At5g01610-like 6.67e-35
Family At5g01610-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_028147m|PACid:17961604
Sequence length 154
Sequence
PSIYDHLSQNGLPIGLLPKGITDFLVEPTTGHFQINLTQPCNAQFENQLHYDFNISGLLS
FAKIGELSGVSQQELFLWFPVKGIRVDVPSSGLIYFDVGVVDKQFSLSLFENPIECTAVD
PNDGPLAFRGSEDSKNQSRKLQFEMAQGDLTATS
Download sequence
Identical sequences cassava4.1_028147m|PACid:17961604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]