SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cassava4.1_030815m|PACid:17970071 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_030815m|PACid:17970071
Domain Number 1 Region: 304-413
Classification Level Classification E-value
Superfamily PH domain-like 0.00000042
Family Pleckstrin-homology domain (PH domain) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_030815m|PACid:17970071
Sequence length 428
Sequence
MRTCTTAQTAEESEPCGDKNLRMSSSSTKSLSQKLENIDENGPALWQQVSCDAPETPIET
MEFLARSWSLSAMELSKALSNTHGASENVEKSPLLSAQAEEQDASATAPKEPHFQQLPNG
AKGSPPISPRESEEMKIYKSIIKGRTMGRWLKDQKERKKQEIRTNNAQLHAAVSVAGVAA
AVAALAASNVMSVEMASTCQKTHSKTPAAMASAAALVASHCIEIAEEMGADHDQILTVVN
SAVNARTSGDIMTLTAGAATALRGANALKARLQKGHGSTAFALVEEKGEEGKESNILAAL
NFVTRGGELLKRTRKGALHWKQVSFNINSNWQVVAKMKSKHMAGTFTKKKKCIVSGVYSD
TPAWPGREKEDCNEQRSYFGIKTAERVIEFECRSKDEKRMWTDGIQHMLNCHTNIKLEAT
FNCCKTSL
Download sequence
Identical sequences cassava4.1_030815m|PACid:17970071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]