SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv11b002100m|PACid:17674604 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv11b002100m|PACid:17674604
Domain Number - Region: 84-175
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000915
Family Myosin rod fragments 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv11b002100m|PACid:17674604
Sequence length 655
Sequence
MDQKSWLWKKRSTEKTLVADKASWEKAEIEAISLKQELDKVLQQKATSDERIGHLDAALK
ECMLQLRFVQKEQDKRVHSAMVKRSDEFEKITIALNEKLADSGKRLAKLDAENTQLSKAL
SGKEKVIEDLSKYRTQIEADFSALMSRVESTEKENASLKYELRVLEKELHIRNEEREYTR
RMADSAQRAKLETSVEPCKYLHFLQEHSLLSASSDVGSEDKASCSESLASHRNMGASDMS
LMYDFAEMEKLAVVSLSADNNIPIPEKSGQKFSSNSSSAIRKVIELVEGINIPSQDSDID
KLLSTKNSEKNPTGYVVRVFQWKSDELSATLQRFVRTCNDLLNGKGDFEQFVVEVASNLE
WVVNHCFSMQDVSCMKDAIRNRLDWDESGSESEVDSGSADNSVENNTSQRDIIEDLNSEM
ETVKQFEGKNGNRVEKEKTTKGELENQFMDSNHEQGKSYDNVLYLEHDLENKDNSCERLE
ETCYDLNKQLKSEEVLDNGSQWEKQLQNDWEITVASEKLAECQETILNLGKQLKALASPS
DAALFEKVINTPDADSVITTASTPQKKISHRSSSLLDKMLADDNNNNQLFHASPETEKDI
QNANDEKFTNKSKTGAAAAASMDIVVPCKRNRGGSFFKKLFWRRKKGKSGKTLSS
Download sequence
Identical sequences A0A022RKA6
mgv11b002100m|PACid:17674604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]