SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv11b015679m|PACid:17678175 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv11b015679m|PACid:17678175
Domain Number - Region: 125-191
Classification Level Classification E-value
Superfamily Tropomyosin 0.000392
Family Tropomyosin 0.0077
Further Details:      
 
Domain Number - Region: 39-76
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 0.0222
Family Kix domain of CBP (creb binding protein) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv11b015679m|PACid:17678175
Sequence length 193
Sequence
VKMTGSQPMSNFNQDGGGSEEDVVVVTLKRHLPFSGQEGLQQLKKIAVRFEERVYTEATS
QSDYLRKISLKMLTMEIKPMNSTANSRQSSNAPINSKKPQEPGQKYPFQLINYSLHMHMH
EVVTKLQQDISLKESKIEELKSKNASLEIRVSDLQARAENDEERYKEMTHLMSELQKTVE
ELHKTVKELQKNA
Download sequence
Identical sequences A0A022QH16
mgv11b015679m|PACid:17678175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]