SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv11b020473m|PACid:17672586 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv11b020473m|PACid:17672586
Domain Number - Region: 8-68
Classification Level Classification E-value
Superfamily Tropomyosin 0.0107
Family Tropomyosin 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv11b020473m|PACid:17672586
Sequence length 80
Sequence
MVKESEHEKIRELSLQLAIAKNRAETSEKQAATYKRQLHMIVGHIEEHNQSLSNKIQKVL
NNVNELESKDGLRYSDNGCR
Download sequence
Identical sequences A0A022QTI4
mgv11b020473m|PACid:17672586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]