SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a000046m|PACid:17680373 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a000046m|PACid:17680373
Domain Number 1 Region: 34-172
Classification Level Classification E-value
Superfamily TRAF domain-like 1.64e-30
Family MATH domain 0.0027
Further Details:      
 
Domain Number 2 Region: 374-505
Classification Level Classification E-value
Superfamily TRAF domain-like 4.09e-27
Family MATH domain 0.002
Further Details:      
 
Domain Number 3 Region: 202-348
Classification Level Classification E-value
Superfamily TRAF domain-like 4.74e-20
Family MATH domain 0.0095
Further Details:      
 
Domain Number 4 Region: 532-656
Classification Level Classification E-value
Superfamily TRAF domain-like 4.25e-18
Family MATH domain 0.0062
Further Details:      
 
Domain Number 5 Region: 1796-1869
Classification Level Classification E-value
Superfamily ACT-like 0.000000000416
Family Glycine cleavage system transcriptional repressor 0.056
Further Details:      
 
Domain Number 6 Region: 1706-1776
Classification Level Classification E-value
Superfamily ACT-like 0.000000000589
Family BT0572-like 0.05
Further Details:      
 
Domain Number 7 Region: 2033-2098
Classification Level Classification E-value
Superfamily ACT-like 0.000000072
Family AF1403 N-terminal domain-like 0.046
Further Details:      
 
Weak hits

Sequence:  mgv1a000046m|PACid:17680373
Domain Number - Region: 913-1071
Classification Level Classification E-value
Superfamily ARM repeat 0.00187
Family GUN4-associated domain 0.078
Further Details:      
 
Domain Number - Region: 1457-1547
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0811
Family Myosin rod fragments 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a000046m|PACid:17680373
Sequence length 2142
Sequence
MAVEDPLRDTSSSASVATTPSTDSLLVDRRDKHSALCKWTIANFPKVKSRALWSKYFEVG
GFDCRLLIYPKGDSQALPGYLSIYLQIMDPRILASSKWDCFASYRLAIENISDSSKSVHR
DSWHRFSSKKKSHGWCDFASLHSLLDPKLGFLHLSNDCILITADILILNEAVSFTRDNEL
QSNNASVTGGGVGSSPVAGDGLNGKFTWKVLNFTLFKEMIKTQKIMSPVFPAGDCNLRIS
VYQSVVNGVEYLSMCLESKDTEKNSLMSDRSCWCLFRMSVLNQKLGNGLNHVHRDSYGRF
AADNKSGDNTSLGWNDYMKMSDFMGPEAGFLVEDTAVFTTSFHVIKELSSFSKSGTLIGA
RNGGNVRKSDGHMGKFTWRIENFTRLKDLLKKRKITGLCIKSRRFQIGNRDCRLIVYPRV
FLEVTDSRNTNSDWSCFVSHRLSVVNQKMEEKSVTKESQNRYSKAAKDWGWREFVTLTSL
FDQDSGFLVQDTVIFSAEVLILKETSIMQELTDQETDSGSTSSQLEGNGKRSSFTWKVEN
FFSFKEIMETRKIFSKFFQAGGCELRIGVYESFDTICIYLESDQSASTDAEKNFWVRYRM
AIVNQKNTSKTVWKESSICTKTWNNSVLQFMKVSDMLEADAGFLLRDTVVFVCEILDCCP
WFEFSDLEVLASEDDQDALTTDPDELVDSDDSDGLSGDEEDIFRNLLSRAGFHLTYGDNS
SQPQVTLREKLLMDAGAIAGFLTGLRVYLDDPAKVKRLLLPTKISGSNDGKISNKNGESS
PSLMNLLMGVKVLQQAIIDLLLDIMVECCQPSEGSSSDDSSDISSKPSQDGSGAISPLEF
DGDAAVTESTQLSMGERLELGIGESTSSSAVQSSDLNGTSIHVKTVPGQPTCPPVTSAAG
FSENPSLRSKTRWPEQSEELLGLIVNSLRALDGAVPQGCPEPRRRPQSAQKIALVLDKAP
KHLQPDLVALVPKLVEHSEHSLAACALLDRLQKPDAEPSLRLPVFGALSQLECSTEVWER
VLFQTLELLADSNDEPLAATVDFIFKAALHCQHLPEAVRSVRVRLRNLGTEVSPYVLDYL
SRTVTSCADIAESIFRDIDCDDDFGDNFSPTPRGVFVFGESGPNSERLHAGEDQTFHGSS
HFSDIYILIEMLSIPCFAVEAAQIFERAVARGAFDPQSVAVVLERRLAGRLNFTSQYVAE
NIEQPDAVIEGETIENMSSQRDDFTSVLGLAETLALSRDLRVKGFVKILYTILFKQYPDE
SHRLRMLKRLVDRATTTADGSREIDSDMEVLVMLVCEEKEIVRPVLSMMREVAELANVDR
AALWHQLCASEDEVLRIREERNTEIASMSKEKAALSQRLCESEATNSRLKTDMKAEMDRF
TRERKELMEQMQEIESQLEWVRSERDEETTKFMAEKKNFQDRLYDAELQLSQLKSRKHDE
LKRLTKEKNALAERLKSAEVARKRYDEELKKIATENVTREEIRKSLEDEIRRLSQTVGQK
EGEKREKEEQVARCEAYIDGMQSKLQTFEQYIHHLESQIQEEMSRHAPLYGAGLEALSMK
ELETISRIHEEGLRQIHAIQQCKVSPAGSPLVSSHPLSQNHGIYPSTPPPMAVGLPPLVI
PNGVGIHSNGHVNGAIGPCKLNSTIQFKTCLINTNSFLLSLVCSLFYYFAHMNTVCSPYC
DPDFDSLPERIFGPACRVTIDNESLEDCTIVKIDSVNRQGLLLEVVQALTDMNLTISKGY
ISSDAGWFMDVFHVKDEIGKKVTDQRVINYIQKALGSNSNTSPNAKARSSPELPLGDTKA
IEMTGKDRPGLFSEISAALVDLGCNIIEVHAWTHNARLACVAHISNQSTDTPIDDHRLHA
IEDHLTTVLRATTAKEENSSNNQQQEVKPAGLPTGDSSTTTKVERRLHQLLLSVRDFDGP
PPQQARLPTRISDSDDEERRGGCHVSIESCEEKGYSIVTIECKDRRRLMFDTVCTLTDMQ
YVIFHASVDSCRGYAYQEYFIRHADGCALNTEGEKDRVAKCLEAAIERRVCEGVRLELCA
YNRVGLLSDITRVLRENGLAVVRADVATQGEKSVNAFYVRDISGNNVDLDFIKSIKTEVG
AIDLEVMEYTTDHSQPITPTSMSIGERLKFQIERLSHGFVAM
Download sequence
Identical sequences A0A022PZC9
mgv1a000046m|PACid:17680373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]