SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a000054m|PACid:17675302 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a000054m|PACid:17675302
Domain Number - Region: 201-362
Classification Level Classification E-value
Superfamily Tropomyosin 0.000562
Family Tropomyosin 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a000054m|PACid:17675302
Sequence length 2025
Sequence
MPLFISEEEFRRCSDDAGVVAEKADAFIRELYSQIETVKAEADAGFITLEQSCSIIEQKY
VSLSGEYSLLQSQQSELSSSLEKRTSELRQVESEKQQLLVQSTEKDGAIERLATEASELH
KSKRQLMLMLEQKDSEVSEKNATIQNYLDKILKLTENAALKDGRLGELESELGRLHATSS
RFSQEKELLERHNAWLNEELKTKVDNVLQLRKENGELEADMSFKLADVERKLKDSSSSLK
YHKDRVKELEEKLSSMERELLSTKEATATAEEHFTAEISTVTKLVDLYKESSEEWSKKAG
DLEGVIKALETHLDQVVSEYKDRLEKEVSATKELEKESADLKEKLQTCEAELENLRKGNE
LIPLPMSSFTTDSFRLANSVDADQMVEDDRAIVPRIPGGVSATALAVSLIRDGWTLNKMY
VKYQEAVDALRHEQMGRKQAQSILERVLYEVEEKAGLIMDERDEHERLVKAYEALDRKLQ
HSLSAHAALEMTILELKASLKRQERDHAAAQKENIDLRKQVAVLLKECRDVQLRCGSVSS
YNDDEHIVGPSISGNSISDIEDIITERLLTFKDINGLVEQNVQLRSLVRILSNQIEEKEA
ELKDKHDKELQMRTEETASKVNAVLLRAEEQSHMIESLHSSVALYKKLYEEEQKHHSHRT
HLQEASTSRKVQEQSSERLKNLEEDLAKSRNEIISLRSARENAALEAKLAQEKLDRFMKD
FEHQREEHNGVLARNLEFSTLIVNYQKQLRESAESLNASSEYSRKLSLEVDNLKHEKEML
KNSEKRASDEVRSLSERVYRLQASLDTIQSTEEVREGTRGLDRRKQEEYINNMEREWAEA
RRQLEEARVNAQHLSIERETASNNALKKIEELNKKCADALQSVAAAENRAVAAEARLSVL
EKIMESAGTKDPHSSEGGQSSSSSEKILATYRDEIENLRAEAQANKEHMLQYKSIAQVNE
EALHQMESALENFRNEADEVKRSLETELNSLRDRVKELEDECKVKTEEALSVNAGKEEAL
AGALSEIARLKDDYSVKMSQIVLMESQISALKEDLEREHQRWRAAQDNYERQVILQSETI
QELTKTSHALASEQKETSELRKAVDLLTTENRDLKSKWETEILAIDVYKSEADKKYSEVD
ELNKILHSRLEALHIKSAERERGLASGTSSHDFAADDGLQNVVNYLRRSKDIAETEISLL
KQEKLRLQSQLESAMKSAESAQSSLHKERANSQASIYSEEEFKSLQLQIRELNLLRESNV
QLREENKHNFEECQKLREAVQSLRSETENLEKLLRDRDSELESSRKEIESLKIEKSHLDK
RIHELLEKCQGVVDINDHNRLKESLQQLQTSSRENDAQLEEYKKLLSEKQDNVLQLERDL
TRIRAELNERDTRINELSQAEASLKSDTEKTRRLNAQLKRKLDSLSRDKEEQSKEVQALS
KQLEEAKQKRNTVDSASEQALREKEKEKDTRIQILERTLERHREDLKKEKEDLKKEKEDH
HKEKEKSHKIRKTIIESRENVLLREAKFSDELKKHQQALAVVEEDVVKLRNSLGVQSEGT
SAIQQFSSTLLEDFASAYFQAVENFDQVVKPVCGDLDSSVPTDASSLDNTLSSGAGQASG
PPAANAPPLTRTTEANDRRLALAKANIKMGRKLVRPNIAKPKEPQGGDVDMSEADESNTV
QGGNATIVPSAATVPSSNTTESQGGNATVVPTTATLTRKRPSASSSSDLQEETLAPEETG
SDLPLKKLKASEETPPQEGGEDLSAVPSKISEVVNIEELSSDSKEEPVDLEKAESEAAEE
QVEEQPTVDEQIQVEPMVEAGEVVVDEKSEKPIEAVVLLSDDQLRDQTEQDIQRIVSESG
GDREEGEVVGDFADNDDDSNVSTETGEFQAEQSVEPESSPIREPPASASLEAGEIEPSQA
LEEEKLVEGVDQAAETEKATEEASTSTSEQGGKPVSPVNNSISTTINLQERARQRASLRQ
AGRGGVAAAAPANSSSTSSPSRGRGRAVRGRVARGGRTARGQSPG
Download sequence
Identical sequences A0A022QYY9
mgv1a000054m|PACid:17675302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]