SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a000105m|PACid:17691122 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a000105m|PACid:17691122
Domain Number - Region: 893-1101
Classification Level Classification E-value
Superfamily Tropomyosin 0.000248
Family Tropomyosin 0.0025
Further Details:      
 
Domain Number - Region: 703-935
Classification Level Classification E-value
Superfamily Tropomyosin 0.000471
Family Tropomyosin 0.0073
Further Details:      
 
Domain Number - Region: 1244-1306
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00811
Family Myosin rod fragments 0.0094
Further Details:      
 
Domain Number - Region: 297-414
Classification Level Classification E-value
Superfamily Tropomyosin 0.0373
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a000105m|PACid:17691122
Sequence length 1780
Sequence
MDPASLSNTNPVDSFRSEPTESTRDDMFVDCPDEIENSESQQSSEEKHTVEDDQYNESDS
GINVQQLMSEIEVLRDMLDNTVAEKEKSAVEYEEERAFLTRELSQFRNQIRVLSEKNNSV
DENANGVVDHIQTMESGASLHEIMDDCSRFLKSALDERLQTDEQVRELQSAVYMKDQDIG
FLNAKVAQAMESSNIAQSDSNLNHVNMSRQIEVLLEKDQQIEEIVNRILASVSLTHHEGD
LLDGSLTEKISSIEKSVTFLVEKCNLFVSDCDQLRGFLNQVGLDFDTIDGKGTFVAARDK
ILDIRSKEENLYQNLSNLEDENRKLVEQLEQQKSTVENVNAEISRLRVEVEQEKNRYANT
KEKLTMAVTKGKALVQQRDSLKQSLAEKTSQLEKYSIELQEKSSALDAAENTKELIAENT
KELIAEKDKIVQKCGEILSEIVATKELQPTDDITEKLRWLVDENKSLSAISLQYNKLADA
LSLFDFPESVASSELDLRVRFLAESFDLSKEEAIKLQSEIAKTKEAANGEIDHLTASLLA
EMQERSYLQAEVDDLRNKYEALKIEIDHLGTSLSAESQEKSYLQLELESLRDKYEGVVQK
EHLVSLEKDKIVSLLMDASGLANDGSEEIRSVHSDITITVDSCLAKIKENMCPSEPSQVH
GEIFENVKSLLYIKDQEMSLYKLIIEEDILDRVQVSYLSGELERKTEELNAVKDEKAVVQ
RSLAQMEDRCALLKDKLSMAVKKGKGLVQERENLKGSLNEKNVEIDRLKSELQQNLDRDK
DCQDQITKLSVDVERIPLLETDLVATKERADQLEQFLAESNGMLQRVMESIDGITTPTDS
SFSEPIEKLTWIAGYLREQEILRTELEQDLREVKDEASSLASKLSEVEVTIKSLENALSI
AENSRSQLLDEKKELEVSKAYLEEELQKENEKTSSHTSNFEKLSASKSALEDALLQAEEK
ISTFMNERDTAVESRDLAEEQLQKLKDDFSDHITKLADADKTIQSLEDALSQAQKNISLL
SEENSKVQIGSADLDSEIKKIREEAHSHASKFSEASVTIKSLEDALLNAENNMGDLVEEK
RNAEQEIIALKSQLESCMEELVGTRGSIETRFVELSSQLNHLWLLLKDEALPLLLGKCFE
RKFESLNDINVLLKEMGDYFLEMDPDMLQDNPVTEDDSSLPTTLPSSLDIALNLDILDDE
VNAVDIESIMLYIEKMNEGFHLKGKIMADKFGKLSTLMDGSIVSLLRRLHVTKDRVISIT
KYAKSLKQQVENINTDKQRQEDTIASLESEIRVLLSACSDATKQLELNAQNNLSEVRFIQ
DYVKLDGRMSMDLETNGDDAAAALDTDHLKTAEKLLLATRQNQDLVKLFKDAMNKVTNMT
EDTRNQMKAIQLTCDEVSEERDLYKDKISMLETDLREQQNLSRDMTIKLEDYEEKEDELR
KREAELLTSLSKVHELEDPLLSASQVKYILEKMNEVEVPDVALAVGDSHDSADVRKLFYV
IDSYNGFLQRVSSLSLENEELQSIADNQILEIEHLQKQLEDLVGNEKDSEKLDKLLELES
GLQNIVRKLRGSDETDVDLKADRSMGLMQLLDKLVMTTVVESESLKSKNEELGAKLFGAQ
KVVDDLSNKVKFLEDSNQTRNVPLEIVEQGRGTSITSSPQSEISEVQDMEAIGKSNNAPH
VLSAAHIRTMRKGSSDHLAINIDSDSERLINNKETDEDKGRIFKSLNTSGLVPRQGKSVA
DRIDGYWVTGSRALMNHPRGRLGLIAYWLVLHMWLLGTIL
Download sequence
Identical sequences A0A022QEE9
mgv1a000105m|PACid:17691122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]