SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a000172m|PACid:17691326 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a000172m|PACid:17691326
Domain Number 1 Region: 38-785
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.25e-283
Family Motor proteins 0.0000000000191
Further Details:      
 
Domain Number 2 Region: 788-883
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.13e-18
Family Motor proteins 0.024
Further Details:      
 
Weak hits

Sequence:  mgv1a000172m|PACid:17691326
Domain Number - Region: 882-937
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00152
Family Myosin rod fragments 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a000172m|PACid:17691326
Sequence length 1500
Sequence
MVAPVALGVGSLVWVEDSDEAWIDGEVLSVNGEDIKVLSTLGKTVVAKSANVYPKDSEAP
PCGVDDMTKLAYLHEPGVLANLKSRYDINEIYTYTGNILIAVNPFQRLPHLYNSHMMAQY
KGAAFGELSPHPFAVADAAYRLMRNEGISQSILVSGESGAGKTESTKLLMQYLAYMGGRS
KSEGRTVEQQVLESNPVLEAFGNAKTLRNNNSSRFGKFVEIQFDQMGKISGAAIRTYLLE
RSRVCQVSDPERNYHCFYMLCAAPEEDMKKYKVGDPRKFHYLNQSKCYELSGVDESKEYI
ATKKAMDTVGISSEEQDAIFRVVAAILHLGNIEFTKGKEIDSSMPKDEKSWFHLKTAAEL
FMCDAKSLEDSLCKRIIVTRDETITKELDPEAAVDSRDALAKVVYSRLFDWLVDKINNSI
GQDPNSKCLIGVLDIYGFESFKTNSFEQFCINLTNEKLQQHFNQHVFKMEQEEYTKEEIN
WSYIEFIDNKDVLDLIEKKPGGIIALLDEACMFPRSTHETFSQKLYQTFKNHKRFSKPKL
ARSDFTVSHYAGDVTYQTELFLDKNKDYVIAEHKDLLCASTCSFVSRLFPVSNEESSKQS
KFSSIGARFKQQLQALLETLSSTEPHYIRCVKPNNLLKPAIFENQNVLQQLRCGGVMEAI
RISCAGYPTKRPFLEFVHRFGILSPEVLKGSTDEVAVCKKLLEKVGLEGYQIGKTKVFLR
AGQMAELDARRTEVLGRSASIIQRKIRSYMAKKNFTLLRRSAIFIQSVCRGELTRCIYER
TRREASCLKIQKYLRMYLARKAYKELRLSAVSIQTGMRGMTARNELRFRQQTQAAILIQS
YCRGYLARSKYIELKKAALTTQCAWRGRVARLELRKMKMAARETGALQAAKNKLEKQVEE
LTWRLQLEKRMRADLEEAKTRENTKLQTALEELQLQFKESKAAMLKEIEAAKVAAAEQQI
PVVQEIPVIDHEMMDKVTAENEKLKAVVSSLETKIDETEKKYEETNKLSEERLKQAVEAE
SVIVKLKTNINRLEEKISDMESENKILRQQSLLTASKLLSENASPLPTKDILLHTPTKVY
ETPDSKPRRPPTDRHHEDVDTFLECVIKDVGFSQGKPVAAFTIYKCLLHWKSFECERTSV
FDRLIQMIGSAIENQDSNNDHMAYWLSNTSTLLFLLEKSLKPAGTAGATPVRKAQPPTSL
FGRMTMGFRSPSSTSLAAAAAAIEKVRQVEAKYPALLFKQQLNAYVEKIYGIIRDNLKKD
LGAILALCIQAPRTSKGSVLRSGRSFGKDSQTNHWMAIIDCLNSLLSTLTENFVPPFLVQ
KIFTQTFSYVNVQLFNSLLLRRECCTFSNGEYVKSGLAELELWCCQAKEEYSGSAWDELK
HIRQAVGFLVIHQKYRISYDEIINDLCPILSVQQLYRICTLYWDDNYNTRSVSTEVISNM
RVLMTEDSNTAVSNSFLLDDNSSIPFSMDELSSSLRVKDFFDVKPATDLLQNPAFEFLHD
Download sequence
Identical sequences A0A022S4U3
mgv1a000172m|PACid:17691326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]