SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a000177m|PACid:17689440 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a000177m|PACid:17689440
Domain Number 1 Region: 32-783
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.57e-285
Family Motor proteins 0.00000000002
Further Details:      
 
Domain Number 2 Region: 785-881
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.97e-16
Family Motor proteins 0.026
Further Details:      
 
Weak hits

Sequence:  mgv1a000177m|PACid:17689440
Domain Number - Region: 869-935
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0889
Family Myosin rod fragments 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a000177m|PACid:17689440
Sequence length 1492
Sequence
MVASVAVGSLVWVEDHDEAWLDGEVISVNGDDIKVLCTTGKTVVVKSSNVYPKDAEAPPC
GVDDMTKLAYLHEPGVLQNLKSRYDINEIYTYTGNILIAVNPFQRLPHLYDSHMMAQYKG
AAFGELSPHPFAVADAAYRLMINEGISQAILVSGESGAGKTESTKLLMRYLAYMGGRLAS
EGRSVEQKVLESNPVLEAFGNAKTVRNNNSSRFGKFVELQFDERGRISGAAIRTYLLERS
RVCQLSDPERNYHCFYMLCAAPPEDIKHLKLGNPRTFHYLNQTNCYELDGIDDAKEYTAT
RNAMDTVGISSEEQDSIFRVIAAILHLGNIEFTKGKEYDSSMPKDEKSWFHLRTAAELFM
CDEKALEDSLCRRVIVTRDETITKELDPEAAVSSRDALAKVVYSRLFDWLVDKINNSIGQ
DPNSKYLIGVLDIYGFESFKTNSFEQFCINLTNEKLQQHFNQHVFKMEQEEYTREEINWS
YIEFIDNQDVLDLIEKKPGGIIALLDEACMFPRSTHDTFAQKLYQTFKNHKRFSKPKLAR
SDFTICHYAGDVTYQTELFLEKNKDYVIAEHQALLSGSKCSFASSLFPVSNEETSKQSKF
SSIGSRFKQQLQALLETLSATEPHYIRCVKPNNLLKPHIFENQNVLQQLRCGGVLEAIRI
SCAGYPTKRPFYEFVDRFGVLAPEALDGSTDEVAVCKKLLEKVGLEGYQIGKTKVFLRAG
QMAVLDTKRTEILGKSASIIQRKIRSYMARKSFILFRRSTILIQSVCRGELARHDYETKR
REASCLRIQRDLRMYIARKAYKEKRASALSVQTGMRGMAARNELRFRRQTKAAILIQSHC
RKFLAHSKYVKLKKATITTQSAWRGRVARKELRSLKMAARETGALQAAKNKLEKQVEELT
WRLQLEKRMRTDLEEAKTQENTKLRTAVQELQLQLKEAKDTLVKEREAAKTAAETIPVIQ
EVPVVDHELTEKLNAENAELKDLVNSLKTKIIETEKKYEETYKLSEERLKQAMEAESMIV
KLKTTMHSLEERIADMESENKIQWQSLLTNKGVPPQSLDLASKDLLLTPEKGFETPDNKP
RRPPIDRQHEDVDALMECVVKDVGFSQGKPVAAFTIYKCLLHWKSFEAERTSVFDRLVQM
IGSAIEDQDSNDHMAYWLSNTSTLLFLLQKSMKPAGTTGTASVRKPQPTSLFGRMTMGFR
SSPSTVNFGAASAALETVKQVEAKYPALLFNQQLIAYVEKMYGIIRDNLKKELGSLLALC
IQAPRTSKGSVLRSGRSFGKESHTNHWQGIIDCLNTLLTTLKENFVPPVLVQKIFTQTFQ
YVNVQLFNSLLLRRECCTFSNGEYVKSGLAELELWCCQAKDEYAGSAWDELKHIRQAVGF
LVIHQKYRISYDEIINDLCPVLSVQQLYRICTLYWDDNYNTRSVSSEVISSMRVLMTEDS
NNAVSNSFLLDDNSSIPFSIDELSNSIEVKDFLDVKPALDLLENPYFHFLHE
Download sequence
Identical sequences A0A022PNW9
mgv1a000177m|PACid:17689440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]