SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a000204m|PACid:17695417 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a000204m|PACid:17695417
Domain Number 1 Region: 1-710
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.09e-259
Family Motor proteins 0.000000000053
Further Details:      
 
Domain Number 2 Region: 710-808
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000122
Family Motor proteins 0.061
Further Details:      
 
Weak hits

Sequence:  mgv1a000204m|PACid:17695417
Domain Number - Region: 862-968
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0915
Family Myosin rod fragments 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a000204m|PACid:17695417
Sequence length 1435
Sequence
MTKLSYLHEPGVLENLKLRYELNEIYTYTGNILIAINPFQKLPHLYHQHMMQQYRGAPLG
ELSPHVFAVADVAYRAMINEGKSNSILVSGESGAGKTETTKMLMQYLAFLGGRAATEGRT
VEQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDKQGRISGAAIRTYLLERSRVCQ
VSDPERNYHCFYLLCAAPKEEIDKYKLGHPKSFHYLNQSKCHELVGISDAHDYLATRRAM
DIVGISKTEQEAIFRVVAAILHLGNIDFGKGKEIDSSIPKDDKSKFHLNTTAELLMCDPV
ALEDALCKRVMITPEEVIKRSLDPLSAAVSRDGLAKTLYSRLFDWLVDKINKSIGQDHKS
KCLIGVLDIYGFESFKHNSMFLSFHIQLQHVFKMEQEEYTKEAINWSYIEFVDNQDVLDL
IEKKPGGIIALLDEACMFPKSTHETFSNKLYQTFKNNKRFVKPKLSRTDFTVAHYAGEVQ
YQSDQFLDKNKDYVVPEYQDLLGASGCPFVAGLFPPIAEETTKSSKFSSIGSRFKLQLQQ
LMETLNATEPHYIRCVKPNNLLKPAIFENQNIMQQLRCGGVLEAIRISCAGYPTRRPFFE
FINRFGLLAPEVLEGHYDEKLACNKILEKKGIKGFQVGKTKVFLRAGQMAELDAHRAEVL
SSAAKIIQRRTRTHIARKHFIDVREATIYMQSFCRSRLACKIYATVKRKAAAIKVQRNTL
RFQARKAYTTLRISVLVIQTGLRTMDACNKFRFRRQTKAATIIQARWRCHRASSYYRKLK
KGTILAQCRLRGRIAKSELRKLKMAARETGALKEAKDKLEKQLEELTWRLQLEKRLRTDL
EETKTQEITKLQNLMEDMQKKVDETNAQLVKEREAAKKAIEEAPPLIQETPVYVEDTKKV
ESLAVEIDGLKASLQNEQEISEDLRKKFAEAQECIEERREKLEETEKKVHQLQESLHRLE
EKLNNLESENKVLRQQAVSIAPNKFLSGRSRSIMQDLHSSSFSEVDDKPQKSLNEKQQEN
QELLIRCISQPLGFSGNRPIAACIIYKCLLQWRSFEVERTSVFDRIIQTIGHAIEKIQDN
NDMLAYWLSNASTLLLLLQRTLKASGAAGMAPLRRRSSSATLFGRMSHSFRGTPQGVNLS
FGNGMPGGGVETLRQVEAKYPALLFKQQLTAYVEKIYGMIRDNLKKEISPLLGLCIQAPR
TSRASLVKGSSRSVANTAGQQALIAHWQGIVKSLGIFLDTLKANNVPPFLVRKVFTQIFS
FINVQLFNSLLLRRECCSFSNGEYVKAGLAELENWCGVATDEYAGSAWDELKHIRQAIGF
LVIHQKPKKTLDEISHDLCPVLSIQQLYRISTMYWDDKYGTHSVSSDVISKMRVLMTEDS
NNAVSNSFLLDDDSSIPFSVDEISKSMEQIDIADVEPPSQIGENSGFSFLLPRIE
Download sequence
Identical sequences A0A022PWH7
mgv1a000204m|PACid:17695417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]