SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a000206m|PACid:17685061 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a000206m|PACid:17685061
Domain Number - Region: 487-708
Classification Level Classification E-value
Superfamily Tropomyosin 0.000141
Family Tropomyosin 0.0044
Further Details:      
 
Domain Number - Region: 200-438
Classification Level Classification E-value
Superfamily Tropomyosin 0.085
Family Tropomyosin 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a000206m|PACid:17685061
Sequence length 1431
Sequence
MSEHFPNQDQMMFPDDSPPSSAPDMSTPMGEFTDESDSVSRRKPAKAFNEVRRGLNFDEV
DEEENDSEDILSLKKAIAELEAEKEAGLVQYQQSSDKLAQLEAEITKTREDFKLLTDHAS
KADDEVVVLKEALSKFEAERESKFQEYKQCLDRISDLETTVSTAEVEAQSLKNELDKLAL
EKDLALDQYMQSLGTISKLENNLEVSKEDAMRLKEKAEKAEGEIEILRQNVSKLTKEKEA
AALQYKQCLETISSLEEKCLVLERANQSFHSEIESLTLKMGNQSHELTEKQKELGRLWAC
VQEERLRFVEAETAFQTLQHLHAQTQEELRAMGSELQNRAHLMKVFESRNQSLQDEVRKY
EEENKHLNELNESSALSIKDMQNEIYSLTESKGKLVEEVELRLDERNALQQEIYSLKEEL
NGLNQKHLSVSDEVKQLQDENSCLKDTSQRESIEKAALLQKLVILEQLLEKNSILEMSLS
DLNAELEAVRGKMEALEQSCRSLMEEKSTLVAELKATNENLEKLSENNTVLESSLSKAQH
QLEALKAKSKILEDSCQLLVNEKAGLITENDGLISRLENTQTRLEELEGRCFDLEREKES
TLRKVEELKMSLELERQEHGNYVQTSDTRFSGVEAEMLVLEDKAMSNEIEILVLRNTARL
LKENSNSMLVKNQKLLHESSLSETKILQLEKKSSEQQFEINSLSDQASVLRAGIFRLLKV
YFKQLLTKLQSMKNSIRKAEEENLEQCVELSVLFTLINQLSTDSKILKVEKTKIEHALLA
RIEGLSEKLMYTQGVCQILEREKLANSDEKSSLTDNIVHLEEKNNVLEEENYVLCDKVLA
LENLSLLFQCFADEKLTALRELGSDRNKLCEMNAALMEKLTSTEARLEESKIENLDHKDK
LQKTDNEFKVVASVRDQLSDEMKNTKEALHQMAIKLQEAEEKISLVEKQKLELSEDNGDL
KTENTFLREASQKLEFNLHELQGEHDKRKIQEENLQFELQSKINEINELEKRAALVFGEL
QYSMVSQLLYEQKYNELRNECFGYIGQNKGLKSQLAAYGPEIASLKECISSLENHTDIHI
KFQNPENKEFQGAEVESISDLRDLRVRLQAIVKSAVEIKEIMVNENIDLHSKLEASARQI
ELLQQQSDDGGRYRRPHRATSEISEADNVLLTKDIVLDQISDSKRQPADVDNQIVESWET
SDPDGTIGLTVGKSKKTFDRNDFRRSISMKKQKDRLLLEKDSSTEKIKPLQEVKNNKKKV
LERLDSDVQKLANLQITVQDLKRKLEVTEKGKRGKAVLECESLKGQLDEADVAVMKMFDL
NGRLMKSVDDRSFSDSKSSFDFEGEEGNTRRRVSEQARRMSEKIGRLQLEVQRLQFVLMK
LDDERENGKAKMAEMKRRILLRDYLYGGGRTGQRRKKGNFCACAQPSVVED
Download sequence
Identical sequences A0A022S5A4
mgv1a000206m|PACid:17685061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]