SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a000292m|PACid:17679915 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a000292m|PACid:17679915
Domain Number - Region: 180-459
Classification Level Classification E-value
Superfamily Tropomyosin 0.000252
Family Tropomyosin 0.0017
Further Details:      
 
Domain Number - Region: 787-834
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 0.0392
Family Outer membrane lipoprotein 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a000292m|PACid:17679915
Sequence length 1290
Sequence
MAEETVISHEIPAAKLANEAESNGVPIKIIEEEAKKEEETALEGEFVKVEKEEKPSVIER
AVSSPEATRELLESQEKIKELENELEKISGVAKEAESENTHLKNEILLTKEKLEESTKKH
EELVLNNKKLLEKSSEAEDKYSEQLKALQEALKAQEEKHTELTNTKEAFDRLSVELETSS
KQMKELELKLQESAEEAQKFEELHKQSGLHVESETKKALELEKLLELAKSSAKAMEDQTA
LLQDELKSLSEKISESEKVEEALKITTAELATVNGELELSKSQVKDVEQRLASKETLISE
LAQELEVAKAAESKTKEDIASLENMLAATKESLHENVSQLEDVKSKLKEEVAAKEGVEEF
LKSHETKAKIAQEDLEKVAKEKQALEDAVSDLTNNMVQMKELCNDLEAKLQQSDENFFKA
DTLLSEAVANSKELEEKLKAIEELHSHKNRELEGTQQALNVATEESKLQLKEFETRCIAA
EQKTVELEQLLNLEELKSHDYQKELRELSQKLSELNGDLTKEVEVKQQLETKLQEFQAKV
AEMESELTKSTSRNSELEIELKNVMEKASEHEGRANTVHERSLELESLIQTSDSKAGDAV
KKVGELELLLETEKNRIKELEDQISLLEKKCENVEAESLKSGKQVSELGAELEVAQLKAS
SLEAALQASTDKEKELSEILNSKTEENGHLKDSSKTLNEKLSETENLLTILQNELTISQE
KLASIENDLKATVIRETEVIDKLKLAEEKLEQQSKALEEVTAHRSELVSSHETLSRETDL
KLQEAVSNFTTRDSEAKDLHEKLQALESQVKSYQVQLVEATERYETANKDLDQILAKLAS
SEGINEELKAKISEAEVKADSYLSENAVLSENIAQLSEKVKGLEEKLTTTVSEKEISAQQ
LASHMNTITELTEKHSKVSELHLAAEARFSEAKAKLEEAINAHSSKDSEAKDLHEKLKAL
EVHVKTHEERAEQASSLVKSRELELEQTLFKSKDLESELEKKSGQFNKETEALIEANSKL
TQDLALYKSELSDLQTKLSSVSSEKDCTVEELNTAKKEVEELRERLVSEGEKLQSQIFSV
MEENNLINETFQSSKKDLQTMIVQLEEQLKEQKSNEDALKSKLEILDKEVVQKVELQNHL
KELEEKLATAEARFEEEKKSIYQKDLEREAALKQSCEEVESKKKEVILLENKVKDLEQSL
QLADAKSKEKDAISEHKDETVKSREIEFESLSSTPSKRKSKKKTEATSTGASPSDTQAHA
AAASPAMNITLVLGVALVSIILGIVLGKRY
Download sequence
Identical sequences A0A022RQR9
mgv1a000292m|PACid:17679915 XP_012830898.1.32330 XP_012830899.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]