SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a000300m|PACid:17679916 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a000300m|PACid:17679916
Domain Number 1 Region: 581-827
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000131
Family Tropomyosin 0.001
Further Details:      
 
Weak hits

Sequence:  mgv1a000300m|PACid:17679916
Domain Number - Region: 835-1005
Classification Level Classification E-value
Superfamily Tropomyosin 0.000144
Family Tropomyosin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a000300m|PACid:17679916
Sequence length 1278
Sequence
MAEETVISHEIPAAKLANEAESNGVPIKVKIFTFYASIVAASTVIRVEIHNFLLTSFQII
EEEAKKEEETALEGEFVKVEKEEKPSVIERANEILLTKEKLEESTKKHEELVLNNKKLLE
KSSEAEDKYSEQLKALQEALKAQEEKHTELTNTKEAFDRLSVELETSSKQMKELELKLQE
SAEEAQKFEELHKQSGLHVESETKKALELEKLLELAKSSAKAMEDQTALLQDELKSLSEK
ISESEKVEEALKITTAELATVNGELELSKSQVKDVEQRLASKETLISELAQELEVAKAAE
SKTKEDIASLENMLAATKESLHENVSQLEDVKSKLKEEVAAKEGVEEFLKSHETKAKIAQ
EDLEKVAKEKQALEDAVSDLTNNMVQMKELCNDLEAKLQQSDENFFKADTLLSEAVANSK
ELEEKLKAIEELHSHKNRELEGTQQALNVATEESKLQLKEFETRCIAAEQKTVELEQLLN
LEELKSHDYQKELRELSQKLSELNGDLTKEVEVKQQLETKLQEFQAKVAEMESELTKSTS
RNSELEIELKNVMEKASEHEGRANTVHERSLELESLIQTSDSKAGDAVKKVGELELLLET
EKNRIKELEDQISLLEKKCENVEAESLKSGKQVSELGAELEVAQLKASSLEAALQASTDK
EKELSEILNSKTEENGHLKDSSKTLNEKLSETENLLTILQNELTISQEKLASIENDLKAT
VIRETEVIDKLKLAEEKLEQQSKALEEVTAHRSELVSSHETLSRETDLKLQEAVSNFTTR
DSEAKDLHEKLQALESQVKSYQVQLVEATERYETANKDLDQILAKLASSEGINEELKAKI
SEAEVKADSYLSENAVLSENIAQLSEKVKGLEEKLTTTVSEKEISAQQLASHMNTITELT
EKHSKVSELHLAAEARFSEAKAKLEEAINAHSSKDSEAKDLHEKLKALEVHVKTHEERAE
QASSLVKSRELELEQTLFKSKDLESELEKKSGQFNKETEALIEANSKLTQDLALYKSELS
DLQTKLSSVSSEKDCTVEELNTAKKEVEELRERLVSEGEKLQSQIFSVMEENNLINETFQ
SSKKDLQTMIVQLEEQLKEQKSNEDALKSKLEILDKEVVQKVELQNHLKELEEKLATAEA
RFEEEKKSIYQKDLEREAALKQSCEEVESKKKEVILLENKVKDLEQSLQLADAKSKEKDA
ISEHKDETVKSREIEFESLSSTPSKRKSKKKTEATSTGASPSDTQAHAAAASPAMNITLV
LGVALVSIILGIVLGKRY
Download sequence
Identical sequences A0A022RSU1
mgv1a000300m|PACid:17679916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]