SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a000335m|PACid:17682669 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a000335m|PACid:17682669
Domain Number 1 Region: 521-709
Classification Level Classification E-value
Superfamily Smc hinge domain 3.27e-46
Family Smc hinge domain 0.0007
Further Details:      
 
Domain Number 2 Region: 26-195,1120-1232
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.15e-41
Family ABC transporter ATPase domain-like 0.00016
Further Details:      
 
Weak hits

Sequence:  mgv1a000335m|PACid:17682669
Domain Number - Region: 327-437
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000204
Family Myosin rod fragments 0.012
Further Details:      
 
Domain Number - Region: 722-881
Classification Level Classification E-value
Superfamily Tropomyosin 0.00327
Family Tropomyosin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a000335m|PACid:17682669
Sequence length 1243
Sequence
MESTATAAGEFVPESTQPASRAPRLFIKEMVMKNFKSYAGEQRVGPFHKSFSAVVGPNGS
GKSNVIDAMLFVFGKRAKQMRLNKVSELIHNSTNHQNLDSAGVSVHFQEIIDLDGGAYEV
VPGSDFVISRVAFRDNSSKYYINDRASNFTEVTKLLKGKGVDLDNNRFLILQGEVEQISL
MKPKAQGPHDEGFLEYLEDIIGTNKYVEKIDESFKQLEGLNEKRSGVVQMVKLAEKERES
LEGVKNEAEAFMLKELSLFKWQEKATNLASENNLAQIAELQATVSSLEENVKIEREKIRE
NLTTLNELETLHAKYRKRYEELDGDLRRCKDEFKEFERQDLKHREDFKHLKQKIKKLDDK
IEKDSTKITDLTKECEDSTNLIPQLEEDIPKLQQLLVNEEKILDEIKENSKAETEVFRSE
LADVRNELGPWEKQLIEHRGKLEVASAEKNLLTKKHEGARAAYEDAQKQISETNRSIETK
TLSVKDTQNKLEKLKLEASEARKTEKACLEEQERLIPLEQAARQKVMELSSVMESEKNQG
SVLKAILQAKESNLIPGIYGRMGDLGAIDAKFDVAISTACAGLDYIVVEKTAAAQACVEL
LRKQNLGVATFMILEKQTNHLHRLKEKVVTPEGVPRLFDLINVQDERMKLAFYAAIGNTI
VAKDIDQATRIAYGGKKDSWRVVTLDGALFEKSGTMTGGGNKPRGGKMGTSIRASVSGEA
VTNAEKELSDLVESLSAVRKRLADAVKFCKESEKAISPLEMEVAKCQKEIESLKLLLVDL
DKQLYSLKAASEPIKEEVNKLKELGKIISSEEKEINRLMQGSKDLKEKALELQNKIENAG
GERLRNQKSKVDKIQSDIDKNSTEINRRKVQIETGQKMIKKLVKGIEESRNEKERLLEEK
EKISSTFKEIEQKAFSVQENYKNTQEIINKHKDVLDQANSDYEKLKKVVDALRTSEVDAE
FKLQDKKKAYVELQIKGKGYKKKLGDLQAALSKHMEQIQKDLIDPEKLQTVLTDVTLVDT
NDLKKALEMVALLEAQLKEMNPNLDSISEYRKKVSLYNERVADLNLITQQRDDIKKQYDE
WRKKRLDEFMAGFNTISLKLKEMYQMITLGGDAELELVDSLDPFSEGVVFSVRPPKKSWK
NIANLSGGEKTLSSLALVFALHHYKPTPLYVMDEIDAALDFKNVSIVGHYVKDRTKDAQF
IIISLRNNMFELADRLVGIYKTDNCTKSITINPGSFVVCEQVS
Download sequence
Identical sequences A0A022R5I0
mgv1a000335m|PACid:17682669 XP_012841354.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]