SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a000383m|PACid:17670636 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a000383m|PACid:17670636
Domain Number 1 Region: 179-923
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.32e-264
Family Motor proteins 0.00000000011
Further Details:      
 
Weak hits

Sequence:  mgv1a000383m|PACid:17670636
Domain Number - Region: 992-1060
Classification Level Classification E-value
Superfamily Tropomyosin 0.00105
Family Tropomyosin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a000383m|PACid:17670636
Sequence length 1199
Sequence
MLSISPNSMARSSLEEMLDSLRQRDDNEKPKDMPPALPARPRSTSRARLPSTKRPLPTSS
GIGEPDTAESSSNSNVDKEERKGLRRNSFGSKNVREMKPGESPYQMAASDEKGHDLKADE
ETKANLANSKSGLLQGFREPELDDNLGYFIKKKLRVWCRLHNVPWQSGQIQSTSGEKASV
RLLDESVVTVPTQDLLPANPDILEGVDDLIQLSYLNEPSVLHNLQYRYSRDIVYSKAGPV
LVAVNPFKDVQLYGNDFVTAYRQNLLDSPHVYALADTAYNEMMTDGINQSIIISGESGAG
KTETAKIAMQYLAALGGGSGGIESEVLLTSCLLEAFGNAKTARNNNSSRFGKLIEIHFTA
AGKICGAKIQTFLLEKSRVVQLAQGERSYHIFYQLCAGAPDGLRGRLRLKRASDYSYLNQ
SDCLTIHDVDDAQKFHMLMDAFNTTRICKDDQEHAFEMLAAVLWLGNISFLVIDNENHIE
VVADEAVTNAAGLIGCGIQDLMLALSTHSIQAGKDKVAKNLTLQQAIDTRDSLAKFIYAS
LFDWLVEKINLSLAMGKQHTGRSISILDIYGFESFKKNSFEQFCINYANERLQQHFNRHL
FKLEQEGYELDGIDWTKIDFEDNQDCLDLFEKRPLGLISLLDEESNFPKATNLTLTTKLK
QHLKGNHRFKGERDGAFTVRHYAGEVLYDTGEFLEKNRDLLHSEIIQLLSSCTSQLSQLF
ASMLKQPQKPASSPIQVGMPACQKQSVATKFKDQLFKLMQQLESTTPHFIRCIKPNNKHI
PGMFDKNLVLEQLRCCGVLEVVRIARSGYPTRMTHQEFTRRYGFLLPENHTCQDPLSTSV
AILQQFDILPEMYQVGYTKLYFRTGQIGSLENVRKQVLQGTLEVQKCFRGHRARRYFHEL
KGGVVTLQSYVRGEIARKEYSILLSLKKQAACKKLDEQLMAVVQIQSVIRGWLVRRYFSS
LQDSKESNVSKRRPGRRSSEIKDLPLEVLPSIVEELQKRILMTEAALGRKEKENAALREQ
VQQFESRWSEYETKMKSMEEMWQKQMASLQMSLAAAKKSLGTDNTTGQPEKHHGAQSPSF
YDSEEMSFGPHTPSGSTPTRILNNGTNTNGGLNSISTLANEFEQSRRNFDHEAQAIVEVK
SADTVNSVEDIRSLKYKFEAWKKDFKVRLREAKAKAHRLGYGDAEKYRRKWWGKRTKRF
Download sequence
Identical sequences A0A022PTP0
XP_012827494.1.32330 mgv1a000383m|PACid:17670636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]