SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a000419m|PACid:17696229 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a000419m|PACid:17696229
Domain Number 1 Region: 136-884
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.8e-264
Family Motor proteins 0.0000000000613
Further Details:      
 
Weak hits

Sequence:  mgv1a000419m|PACid:17696229
Domain Number - Region: 956-1027
Classification Level Classification E-value
Superfamily Tropomyosin 0.0036
Family Tropomyosin 0.013
Further Details:      
 
Domain Number - Region: 885-928
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0438
Family Motor proteins 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a000419m|PACid:17696229
Sequence length 1168
Sequence
MSQTKARKPSSFQSIKSLPTDFRFMGGDQDGDEMMLSDTIPENVEAEESDNDESPYSSLD
ISAKDEISSNGDNNGHNDFKDTTNTNPVRSPKKSHVDSKWGDTTPYASKKIVQSWVQLPD
GNWELGTTIRTFDNESLLVLDEGKVLKVKTETLVPANPDILVGVDDLMQLSYLNEPSVLY
NLQYRYNQDMIYTKAGPVLVAINPFKKVPLYGNDYIEAYKRKSVQNPHVYAITDTAMREM
IRDEVNQSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILKTNPILEAFGNAKTLR
NDNSSRFGKLIEIHFSETGKISGAKIQTFLLEKSRVVQCSEGERSYHVFYQLCAGAPPTL
REKLHLKSAAEFKYLSQSNCYTISGVDDAEQFRVVTEALDIVHVKKEDQERVFAMLAAVL
WLGNVSFTVVDGENHVEPVLDEGLTNVATLLGCNVEELKLALSTRKMRVGKRNDTIVQKL
TLAQAVDTRDALAKSIYSCLFDWLVEQINKSLAVGKRRTGRSISILDIYGFESFERNSFE
QFSINYANERLQQHFNRHLFKLEQEEYIQDGIDWAKVDFEDNQDCLNLFEKKPLGLQSLL
DEESTFPNGTDLSFANKLKQHLDSNPCFRGERGKAFTVRHYAGEVRYETTGFLEKNRDLL
HVDTIQLLSSCTCHLPQAFASSLLNQSDKPVVGALHKSGGADSQKLSVTTKFKGQLFLLM
QRLENTTPHFIRCIKPNNFQSPGTYNQGLVLQQLRCCGVLEVVRISRSGFPTRMSHQKFA
RRYGFLLLDHVASQDPLSVSVAILHQFNILPEMYQVGYTKLFFRTGQIGVLEDTRNHTLH
GILRVQSCFRGHQARCHIKELRRGISTLQSFIRAEKTRKEYAILLQRHRAAISIQTQVKA
KIFRKNLKRLSDASTVVQSVIRGWLVRRCSGDIALLQFGGRMGNETEEVVVKSLFLAELQ
RRVLRAEAALRVKEEENDILHQRLQQYDNRWSEYELKMKSMEEVWQKQMRSLQSSLSIAK
KSLSFDDNSHRNSDASVNGNNDERDSSSSWDTGGILRIHQSSNGGRSAASPGLTVISRLA
QEFEQRSQIFGDDAKFLVEVKSGQTEASLDPDRELRRLKQMFEGWKKDYGSRLRETKLIL
NKLGSENGSSAGKPRNKWWGRMNSSRMN
Download sequence
Identical sequences A0A022RHE5
mgv1a000419m|PACid:17696229 XP_012834994.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]