SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a000458m|PACid:17675676 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a000458m|PACid:17675676
Domain Number 1 Region: 127-864
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.71e-258
Family Motor proteins 0.0000000000896
Further Details:      
 
Weak hits

Sequence:  mgv1a000458m|PACid:17675676
Domain Number - Region: 865-908
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0127
Family 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain 0.094
Further Details:      
 
Domain Number - Region: 936-1001
Classification Level Classification E-value
Superfamily Tropomyosin 0.0199
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a000458m|PACid:17675676
Sequence length 1138
Sequence
MSQKKVKGSPSLQSIKSLPVDLRFVGSSGSNRMNLSDNVSDNVELSSDSAQGRSDIGSEN
DESPYYNLDMPAKNTPTRSIKRSNVDSKWSDTTPYTTKKKLQSWFQLPDGNWELATILQT
SGNESLISLADEKVLKVNMESLVPSNPDILDGVDDLMQLSYLNEPSVLYNLQYRYNQDMI
YTKAGPVLVAVNPFKKVSLYGDDYIDAYKCKSMASPHVYAITDAAMREMIRDEVNQSIII
SGESGAGKTETAKIAMQYLAALGGGSGIEYEILKTNPILEAFGNAKTLRNDNSSRFGKLI
EIHFSETGKISGASIQTFVQSSAGERSYHIFYQLCAGAPPLLREKLNLRNADEFKYLSQS
NCFTVSGVDDAEQFRVVTEALNIVHVAKESQDSVFAMLAAVLWLGNVSFTVIDSENHVEP
VVDEGLVNVATLIECNIEELKLALSTRKMRVGNDTIVQKLTLPQAIDTRDALAKSIYSCL
FDWLVERINKSLAVGKIRTGRSISILDIYGFESFERNSFEQFCINYANERLQQHFNRHLF
KLEQEEYIQDGIDWTKVDFEDNQDCLNLFEKKPLGLQSLLDEESTFPNGTDLSFANKLKQ
HLNSNPCFRGERGKAFTVSHFAGEVTYDTTGFLEKNRDLLHLDSIQLLSSCTCPLPQAFA
STMLTQSEKPVVGALYKSGGANSQKLSVTTKFKGQLFQLMKRLENTTPHFIRCIKPNNTQ
SPGSYSQELVLQQLRCCGVLEVVRISRSGFPTRMTHQKFAKRYGFLLLDHVASQDPLSVS
VAILHQFNILPEMYQVGYTKLFFRTGQIGVLEDTRNRTLHGILRLQSYFRGHQARCRLKE
LKRGIVTLQSFFRGEKTRKEYSVLLQRHRAAIHIQKRIKARICRNKFRRLNEASTAIQSV
IRGWLVRRCSGDIGLLQFGERKGTEPEEVLVKSTFLAELQRRVLRAEATLREKEEENEIL
SQRLQQYENRWSEYELKMNSMEQVWQKQMRSLQSSLSIAKKSLAFESDYSQRNSDASVNE
NDDQESTIWETKAHEINGVRSSTSAGTGVIGRLAEEFEQRSQVFGDDAKFLVEVKSGQVE
AGLDPDSELRRLKQMFEGWKKDYGARLRETKVILHKLGNEEEPTRKKWWGRRNSTRMG
Download sequence
Identical sequences A0A022R6E7
mgv1a000458m|PACid:17675676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]