SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a000524m|PACid:17691478 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a000524m|PACid:17691478
Domain Number 1 Region: 238-629
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.31e-93
Family Regulator of chromosome condensation RCC1 0.00068
Further Details:      
 
Domain Number 2 Region: 19-124
Classification Level Classification E-value
Superfamily PH domain-like 1.56e-24
Family Pleckstrin-homology domain (PH domain) 0.0027
Further Details:      
 
Domain Number 3 Region: 628-698
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.34e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 
Weak hits

Sequence:  mgv1a000524m|PACid:17691478
Domain Number - Region: 833-906
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0785
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a000524m|PACid:17691478
Sequence length 1097
Sequence
MADLVSYGSNAHRDFDLAVIALKKGAQLLKYGRKGKPKFYPFRLSHDETSIIWISSSGER
SLKLASISRIIPGQRTAVFQRYLRPEKEYLSFSLIYNNGKRSLDLICKNKVEAEIWIAGL
RGLISSSGQAGRSKIDGWSDGGLYFDDNRDLTSNSPSNSSVSATREVTSPEVSISSSTIA
SPKSNRSDTLAYSERSHASLDQTNMHAKGSGSDAFRVSVSSAPSTSSHGSAPDDCDALGD
VYIWGEVICESVVVKVGPEKNASSVDTRADVLLPRLLECNVVLDVHHVACGVRHAALVTR
QGEVFSWGEESGGRLGHGVGKDVSQPRLVESLTFTGVDFVACGEFHTCAVTMAGELYTWG
DGTHYAGLLGHGTDVSHWIPKRIAGPLDGLQVATVTCGPWHTALITSTGQLFTFGDGTFG
VLGHGNRENVSYPREVDSLMGLRTIAVACGVWHTAAVVEVIVTQSSASISSGKLFTWGDG
DKNRLGHGDKEPRLKPTCVSALIEYNFHKIACGHSLTVGLTTSGRIFTMGSTVYGQLGNP
HSDGKLPCLVDDGLAKECVEEISCGAYHVAVLTSRNEVFTWGKGANGRLGHGDIEDRKSP
TLVESLKDRHVKFIACGSNYTSAICLHKWVSGAEQSQCSACRQAFGFTRKRHNCYNCGLV
HCHACSSRKAPRAALAPSPSKPYRVCDSCFAKLSKLAEAGAHNRRNSGLPRLSAENKDRL
DKADLRLVKSSAMLSNFDLIKQLDNKAAKQGKKGDAFSLGRSSQVSLLQLREAVVSTAID
LRRNVPKPVLTASAVSSRSVSPFSRKPSPPRSATPVPTTSGLSFSKSINDSLKKTNELLN
QEVHKLRVQVENLKNRCEVQDSELQKSAKKTQDALTLAAEESAKCKAAKEVIKSLTAQLK
DMAERLPPGAYDPESLKLIYMPNGFEPKRETDSRSDSGPSELVGSAAVRNESTSNGTNNG
FDSRLSNGGANNSQSYRTTLSENLENRESGPSHEDETESNSRNSVVPVNAGQIESEWIEQ
YEPGVYITLVALRGGTRDLKRVRFSRRRFGEHQAETWWSENREKVYEKYNVRGSDKSSVS
GQAARRSERGFSPSSQV
Download sequence
Identical sequences A0A022PRP2
mgv1a000524m|PACid:17691478 XP_012829564.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]