SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a000615m|PACid:17694515 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a000615m|PACid:17694515
Domain Number 1 Region: 360-717
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.28e-118
Family Motor proteins 0.000000319
Further Details:      
 
Weak hits

Sequence:  mgv1a000615m|PACid:17694515
Domain Number - Region: 261-361
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000497
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a000615m|PACid:17694515
Sequence length 1043
Sequence
MENSFEQYPEIQIPDPCVSCRDFNWENTKNSNPEIEASAMEEDENGESLADLMVCDSGSR
LVPSGFINPPCSDEIVLFVMLNLPPGDYSLDLHFVDIININGPKGMRVFNVFMQDEKILS
DFDIFSIVGSEKPLQLVGVRVAVKDDGILVLKFEGIHGHPVVSGICVRRAPKTSASQLDR
EFFVCKNCSTEIELPSAQKKVMRMKSIAKYEKNIQELRNMLKQKTDECYQSWMSWTSANE
QLEKVRMDLDNKTFKAYSLDQTLEKQADKLRDISSKYEHDQKSWTVAVNTLEQKVKVMKR
EHSQLSREAHECVDSIPDLNKMVFAVQSLVDQCEELKVKYNEEQIKRRKLHNQLQEAKGN
IRVFCRCRPLSKTEVVSGCASVIDFDSAKDGELGILSNNSNKKTFKFDRVYTPKDDQVDV
FADAAPMVISVLDGYNVCIFAYGQTGTGKTFTMEGTEVNRGVNYRTLEELFKIANERTET
YTYNISVSVLEVYNEQIRDLLAVETSKKLEIKQASEGFHHIPGIVEAKVENTQQVWNVLQ
AGSSARAVGSNNVNEHSSRSHCMLCIAVKAKNLITGEYTKSKLWLVDLAGSERLAKTDVQ
GERLKEAQNINRSLSALGDVISALANKSSHIPYRNSKLTHILQDSLGGDSKTLMFVQISP
SDHDLSETLSSLNFATRVRGVELGPIRKQIDTSELQRMKTMLEKVRQESRSKDESVKKLE
ENLHNLENKAKGKDQVYKNQLDKIKELEGQIELKASLHCQSEKQVLSISEKLKAKEEYCS
TLKQKVMDLENKLKQQEEIQSITYQNKVNDLENKLREQVQQSESACIILQHKVKELEGKL
KEQEDNLECLSLNQKIKELEDKVREQEKQLAENAREQEKQLEDKVRDQEKQLTAETPFSL
KSTPVEESKQSLKEESITNDSEHRVLRSLSHQINRRGSQISSHTVVVKESESLQEIRKKR
LSRNSEVENNSSVVVSDNNNNNNNNKIRHSDPPRPVSRVPRATAKPVVAPQRPVAGPVAR
TKTSRDPVQAVKERDSKKRMWSR
Download sequence
Identical sequences mgv1a000615m|PACid:17694515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]