SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a000626m|PACid:17682808 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a000626m|PACid:17682808
Domain Number 1 Region: 766-934
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000392
Family Tropomyosin 0.0058
Further Details:      
 
Weak hits

Sequence:  mgv1a000626m|PACid:17682808
Domain Number - Region: 68-272
Classification Level Classification E-value
Superfamily Tropomyosin 0.000595
Family Tropomyosin 0.0034
Further Details:      
 
Domain Number - Region: 61-105
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.035
Family Shikimate kinase (AroK) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a000626m|PACid:17682808
Sequence length 1041
Sequence
MDKRSWPWKKKSSDKQAAEKVAATLSDSSAAASDTGATPQAEKVKQETNKKPKYVQISME
SYTHLTGLEDQVKSYEDQVQSLEDEVKELNEKLSEADSEMTNKENLVKQHAKVAEEAVSG
WEKAEAEAAALKNTLESVTLLKLTAEDRAAHLDGALKECMRQIRNLKEEHEHKLHEVVLN
KAKLFDKMKLEFESRIDKMDQELMRCASDNSALSRSLQDRSNMLIQLSEEKSEAMAEIER
LKSNIDSYEKDVNSLKYEVHIARKELEIRNEEKNMSVRSADVANKQHLEGVKKIAKLEAE
CQRLRGLVRKKLPGPAALAQMKLEVESLGRDYGDSRLRRSPVKPPTSPHLSEFSIDNAHK
YLKENELLTERLLAMEEETKMLKEALAKRNSELQASRSFSAQTASKLHSLEAQLQANGEM
GSPLKSSTHVSAEGFSCKKAASFTSMSEDGNEDSVSCAGSSGTGLMSEHSHFKKERNIDS
PHKSENTNRLDLMDDFLEMEKLAYLSNGTVSSNAESELVKDEVSVEVTVHTDSQSDDQCV
TLANHQLQADPLVFVKLQSEISRVLESLSNEKDMEKVTDDIRCVMEDMRETLHQHSANGV
ANTVETTNQKLETAISQIYDFITILGKEVSSLPAATPDEDGLNQNLNMFSAKYIEPLPRD
INLIDYLLDVSHVLTKASELHFNVLGFKSSEVETGSSDCIDKIALPENKAVVDSLGERYP
PIGCAHFSDSASDPDIPNDGNLVPISESTATSWKCSFEEFEELKMDKDNLAVDLARCMEN
FENTKSQLLVTEQLLAEVKSELTSAQKSNSLAETQLKCMAESYRSLETRAEELQTEVNLL
KGKIQNLDSELQEERRSHQEATNRCNDLQEQLERIDKITTADIDDKPSQEKDLAAAAEKL
AECQETIFLLGKQLNSLRPHTDTASSPNSTRSQKIEASAEQEPTISGTNLRDIDPSEMDT
VTSFHLDRAGSESPLDLFTAPFSPSDSDPNNLLRSPVGSKYPNHHRPSKSGSSSSSSSTP
TPEKHGRGFSRFFSSKGKINE
Download sequence
Identical sequences A0A022RFN5
mgv1a000626m|PACid:17682808 XP_012835745.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]