SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a000713m|PACid:17671029 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a000713m|PACid:17671029
Domain Number 1 Region: 12-399
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.54e-118
Family Motor proteins 0.0000000163
Further Details:      
 
Weak hits

Sequence:  mgv1a000713m|PACid:17671029
Domain Number - Region: 647-728
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0327
Family Apolipoprotein A-I 0.033
Further Details:      
 
Domain Number - Region: 417-486
Classification Level Classification E-value
Superfamily Tropomyosin 0.0392
Family Tropomyosin 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a000713m|PACid:17671029
Sequence length 1009
Sequence
MSNRQEKEKGVNVQVLLRCRPFSDDELRNNAPQVLSCNEYQREVAVSQSIAGKHIDRVFT
FDKVFGPNAQQKDLYEQAVVPIVNEVLEGFNCTIFAYGQTGTGKTYTMEGESKRSKACHN
GDLPPEAGVIPRSVKQIFDTLESQNAEYSVKVTFLELYNEEITDLLGPEDLSRVVSEDKQ
KKQLPLMEDGKGGVLVRGLEEEIVTSASEIFTLLERGSAKRRTAETLLNKQSSRSHSLFT
ITIHIKEATPEGEELIKCGKLNLVDLAGSENISRSGAREGRAREAGEINKSLLTLGRVIN
ALVEHLGHIPYRDSKLTRLLRDSLGGRTKTCIIATVSPAVHCLEETLSTLDYAHRAKHIK
NKPEVNQKMMKSTLIKDLYGEIDKLKAEVYATREKNGVYIPKERYYQEESDRKAMADQIE
QMGVTIENHQKRMEELQAKYEGQVEQYTQLNSKLNATQKDLNQTSKLLADTENELKRCQY
FLKERDFIISEQKKSENALAHQACVLRADLEKCQKDNASLFLKIAREDKLNAGNRSTVNS
YQADLTQQLDTLCKLLAGSTSQQSEHLQCVENLCISFLEVHDMAAVELKKKVSTSKALCI
SHFEAVQNVIRLHKAGNNAALDELSALASSNSQSIEKLLAEESIEVNSVFDDLQQTLSSH
QGEMAHLVRELRQRFNASIEHLTNTSESLHGFLEKLSKESERLGSHAAQVDKVQTKCITE
FRKAYEEKSKSDAKKLIADMTSLVSDCMRRQKEMVDARLGDLNDSVVGNKMFLDGHASTV
DGITSDLKRKWQECFTQAESNFNDNADFSAAKHCRMELLLQKCVNTADTALNKWQTTQKS
LTSMGSQHASTITSHVRSMNESNEQHDVEVESARVTVEDDAQQSGEDIIRCFDGLSEQEK
LSVSQILTTARAHSEIIENLNRDHSEQASCIEKHAVDTFTHKYTDYEPTGSTPTRCEPDI
PSKGTIESLCSMPMEALQEEFRENHSYESFQGKEQKSLLNPREPLSQIN
Download sequence
Identical sequences A0A022R6A2
XP_012839732.1.32330 mgv1a000713m|PACid:17671029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]