SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a000800m|PACid:17671553 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a000800m|PACid:17671553
Domain Number 1 Region: 163-460
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.43e-63
Family Extended AAA-ATPase domain 0.062
Further Details:      
 
Domain Number 2 Region: 525-541,579-749,809-955
Classification Level Classification E-value
Superfamily L domain-like 3.26e-42
Family Polygalacturonase inhibiting protein PGIP 0.067
Further Details:      
 
Weak hits

Sequence:  mgv1a000800m|PACid:17671553
Domain Number - Region: 13-82
Classification Level Classification E-value
Superfamily Tropomyosin 0.085
Family Tropomyosin 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a000800m|PACid:17671553
Sequence length 982
Sequence
MVDAIVSVVVERLAATLEEKVRKEVNLVRGVEDEIRSLSDDLKKVRNVLEDAEKKGYKDK
SVKDWLTRLENTTYEMDDVLDEWNYSVLKFRIEQSSDLDVYVPPKKKVWSSFVPSSCLCF
KKVLTRHEIALKIEQVKTRLDLILGEQVRFGFHEIKSQPNEPSHQSSRVQTTSLIDLEEV
CARKFESENLVSKLVGGGGGGEELDVSVLSIVGTGGLGKTTLAKLAYNDTRVEKHFELRI
WICVSDPFNEVEIAKGIVVASVKKFDNPPNTNYQLEILLQSLKETISLEMVLQSLKESIS
GKKFLLVLDDVWTEDSTKWESLRICLKGGGLGSRILVTTRNERVALMMGSVKNDIHHLGH
LSHEECWLLLSRIALSGKCEKEREKFQNIGREIANKCKGLPLAAKTLGSLLCFKNSVEAW
DNVLNSEIWELEEVEDDLFRHLLLSYKELSPTLQRCFSYCAAFPKDTEISVADIIRRWFA
MGYLGYGSDWEVRGREYFDKLAMRSLFQDFSKTSNLDEESIASFKMHDIIHDFAQFLRNN
VGSRMKETNCQTCSPLLVSQVEKYRSLFLTRELYDPHFCDGLTSVRLLSLRKCGLEGIPE
EIEKLIHLRWLDLSWNYFGAENGLKSICKLYNLQFLLVGGCKIKEIPREIGNLIQLKELD
LSSNTVIEELPESMCNLRELESLNINSCVALVRLPQGIHRLVNLKHLYNEGTNSLKQYPQ
GLAQLTNLVTLKKFHNQDGSKLGWLKNLNQLSDSLDLTIKLTSGDDSAEVEDAREVELRK
KTRIRNLVIFFNESTMGGEEVMKEASAWNDILDALEPHPNLRKLTICEYKGSRLPRWIAS
PLNQLTFIFLYNCEYLASLPPLGKLPLLKTLRISGLSELKFVGREFLGITTTTTTSIIGG
FPKLEELLFEDCPEWKEWEDITAEEDCDGVSIMPCLTELIINCCDGLTELPQRLMRKPQA
LKMKILSPLASKAHHTPPPSLQ
Download sequence
Identical sequences A0A022S0M8
mgv1a000800m|PACid:17671553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]