SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a001004m|PACid:17686105 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a001004m|PACid:17686105
Domain Number - Region: 378-436
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00471
Family Myosin rod fragments 0.0043
Further Details:      
 
Domain Number - Region: 592-705
Classification Level Classification E-value
Superfamily Virulence-associated V antigen 0.085
Family Virulence-associated V antigen 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a001004m|PACid:17686105
Sequence length 915
Sequence
MWERNARKLMIDLDISKKEFSDLSKKEKELVVELSAEHAEKDGLNKEVAKLKLELQNRAI
KEDSVGQSEGLVQIQKVLENEIKYQQDLNHNLDQQLKQSQESNIELVSVLQELEETIEKQ
RIKIENLESSVAKISMGNSKLEGDVRLLEESLRDKTDEIASLEATLSGYGKGEHFEALDD
NSNENDVREIELLREKIRELEKDCTELTDENLELLFKLKESNKMDMRKCASFDSMSSEHA
TNVCCPSDDSEVSDRKFQICHLEEELKKKVEEEQNVSENYSELNKILEMKLAESEKILEE
LEKSKAESDETLEIDVLEANLVAKVQEVDFLSREKIRLEQNIELALREKNISLESLENLQ
NDLTALRGAVGSHVSANENLERDLETVENKRRELENSLSGLHEENTRLHERIKQLKDENE
SLTFDLERKFDDMQKQWLLAQEECEYLKQEMKLRNSNSEVETENQELRENCSALVAQLNE
SNKSLSDCSLKVELLEGRLASMVDDFEVRENGLKSQLDALVKENSCQKEKLALEESLHQM
YLEKSTEFESLSKQLLSEARKERERISLEASGEISRLIAERDELRASLEEVKLKAESYDS
KLEAAMRESELAIQELTGQLVDSKRSLERALSSLAGYKRNDEKLKSELNDLELKLTISDY
ERQQLIKETSNLKVQLQSLSILRDEISTLKSELEDCRVDKGKFEHALKTISGDYEEVKAE
NNLFKEKVSEFEECKRTKLALEEKLLQMEKELSEKEILCVRKTDLENELTEMKKSNVEFQ
KKMYRLEEERDECLKKAQSLEENIKLMEERNINNNNMHEEGGYNRDFDGESPLAISVDPT
TKQQLFENEVAEGSDANNRVLHGRYERTKSSFETELRELRERYLEMSLKYAEVETQREDL
VMQLKAARSGKRWFA
Download sequence
Identical sequences A0A022RRP0
mgv1a001004m|PACid:17686105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]