SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a001008m|PACid:17681763 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a001008m|PACid:17681763
Domain Number - Region: 689-891
Classification Level Classification E-value
Superfamily Tropomyosin 0.053
Family Tropomyosin 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a001008m|PACid:17681763
Sequence length 914
Sequence
MKKLFFFRSHSSNTVNNNQLSPPSTDKQVYWEKPTEKVDKSVKNKHGFEEQEFGSSPCLR
RSLSFSSGSPYETGKGPSKNYNPTGSPCHATYYSNKHSSRPRALTPERQPRSKRVDDARR
MEKFDRVISRANSDLLESSSHCSSNVSNKVLDRYIDGEQQMEEFEPKANYFMKNQFENGN
GLVKRPPKFQFSAPVSHDGRIQKPKSQSFRETKHVGENGYGNESPRKLAKNVVERLSKSQ
FFPTMRSKESDGDSPITIDDVYGRNMNRCSNAYADEVSSRKCSMDWHMETKEEMPEFLEG
TFSDDKERAGEYIDILADTDVELFKKFKEAEDRAAILSKEFERGNFFEFRELSVPTLIQK
IRSLTEEKVNMAIEVSAILEDRIAEKALFREKLKIAREDAQSRRLEKEKNELQLTLEREL
DRRSTEWSHKLDKLQAEEHRLRERVRELAEQNVCLQREVSSSGEREMDSRTRITNSENQL
GNLSAQVKEAKEENQYLQKTLSEMQEKTRAAEEDLDCIRRNYEEKVTECKDMHQSISRLQ
RTCSDQGKTIDGLRGLCEELGKKISQENFDFEFVKLPVEHMRLTGVEHALRKEVESYRVE
VDSLRHENIDLLNRLKSNGKEGSFSTYKLDGELQSRISLLQSQMLPLLMESNQLGRKLIE
YVKANGGFPLKKGPASASCLDGQVLVECEVKLQGLERTAESLTTSIQTVSAVLQEKSTLL
QDSQATDESHKRNEQKQEDVIRTELKAETLLTSLLREKLYSKELHMEQLQAELAAAVRGK
DVLKCEVQNAEDNFSCIKHKMKELELHMMKKDETINQLQSDLQECKKELAIVRGILPKVS
QERDSMWEEIKQYSEKNMLLNAEINMLRKKVESLDEDILVKEGQITILKDSMGKSFDLLA
SPDTNENFCWTNMR
Download sequence
Identical sequences A0A022QWY1
XP_012842484.1.32330 mgv1a001008m|PACid:17681763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]