SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a001163m|PACid:17671732 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a001163m|PACid:17671732
Domain Number - Region: 234-310
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000392
Family Myosin rod fragments 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a001163m|PACid:17671732
Sequence length 874
Sequence
MSRILRFSGIKNLEQFKSLSGSNMGASNAKMHSSSTVAPPHPVSTGSFANLKLTAEKLVK
EQASAKNDLELANSKLRKLTEQISMLEEKLRNAFNENAQLKVKQKEDEKLWIGLESKFSF
TKTLCDQLTETLEQLNVQVQLAEKDKAFFEDKISATSAVLDKLHEHMKSMSLKLDSSEET
IKTREKELMELGLEKGKLETSFRNEQSRTTCLIEEKDGTIKQLEEDVAANKMALESLTSK
MENMQLEMRVKEDDLLQLSVTKENLEREIKDLLSSKNDLANRLDMAFKEIKNLEDFVNTL
VVKFTELEHQSLTFSEKVVELNGLFDSSVKLAQQEKDLISKSAQQKFDQIENHRTCVISE
RNALQFVNHDLNNKVLELQKEQEFAMVQHAEECRLAEEKIRKLESELETLVSKQSEMQAR
ILKMEDDLLTSSETSTLSDKRMQALLLQLSELETHSKGVVDGLKADILKKQDEIDLLQKE
VEKNGESVGSLEKTVSELERALEEKDQIVAELKTRENEFDDQKAEIAASLANAESKLDEA
KKQYDHMLESKQLELSKHLKEISQRNDMAINDIRRKYEVEKQEAVNLEKEKADKVIQDME
QKSELKIAQYKEESRQQLLRVQEEHAALVIKIQQEHDNKEMSLTYKHSEELKRAQLQAET
ELREKIKSLRSDHEAQLRALRCEHEDDCKRLEEELAVQKTKEERQRALLQLQWKVMGDNP
QEDQEVTSKKNYSISSSKKRNKDSDKRTQHTLDRTEVEEKDSPYPKAIQTPVSNLLKKAE
NVNDIPKHSRKVTHHEYEIETSNGRTITKRRKTKSTVMFEDPRKHRKRNTPKARTPKNVT
QGVKGGVPPKPSNIGDLFTEGSLNPYADDPYAFD
Download sequence
Identical sequences A0A022Q6U2
XP_012854977.1.32330 mgv1a001163m|PACid:17671732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]