SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a001242m|PACid:17689288 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a001242m|PACid:17689288
Domain Number - Region: 198-422
Classification Level Classification E-value
Superfamily Tropomyosin 0.000484
Family Tropomyosin 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a001242m|PACid:17689288
Sequence length 855
Sequence
MSAKSKSALPETPNSKVSPATPRVSKPSSRGVAKPDADSASPLQNSRLSIDRSSPRSVPP
KPALDRRSPKLATPPDVNKKITRVSKPSEVQTELNLAQEDLKKAKEKLVLIEKEKGKALD
ELKEAQRLAEEANEKLREALVAQKRAEENSEIEKFRAVEMEQAGIEVAQKKEEEWQKELE
TVRNQHAVDVAALLSATQEIQKVKQELAMTYDAKNQALSHADDATKIAEAHAEKVEALSA
ELVHLKSMLDSRVEMEDSENNKLVSELKSEIDSLREELEEAKTLEEELAEKEAALEQLNV
DLEAAKMAESYSRNLVDELHGRLEELASQTEQAKRLERSASESLESVMKQLEGSNDALHD
AESEISALKEKVGLLEITITRQKRDVDETEICLELAEQKASEMVKKVESLSSELEAVKEE
RAQSLDNEKLAATSVQNLLEEKNKLINELEISRDEEEKTKKALESLASALHEVSSEARDA
KERLLSVQVEHENYETQIEDLKLVLKATNEKYESMLDGAKQEIDGLTKSIEQSKHDYQNL
NAEWEQKELHLMNAKKKSEEENSSLESEINRLVNLLKMAEKETCATREEEDRWKKSFKES
ESEVIYLKEVLGEAKAESMRLKEGLMDKENELQNILQENEEIQKREAASLKKAEELSKLL
EEALAKKHVEENGDLSDSEKDYDMLPKVVEFSEQNGVGDAIAKAELHSQVQLEQPAHVNE
KVVEVNDVSSIDESVEKVSEVKKSNGELKENDKDKDKESKDSAEVDLKMWESCKIEEKDF
SLEAEAEVEPESFEDEVDSKAEGVDSSDQVNGLSSSENLDNGGSSPAKQSSSQKKKKPLL
SKFGSLLKKKSTTKS
Download sequence
Identical sequences A0A022PY18
XP_012858432.1.32330 mgv1a001242m|PACid:17689288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]