SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a001279m|PACid:17690476 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a001279m|PACid:17690476
Domain Number 1 Region: 3-365
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.25e-120
Family Motor proteins 0.000000561
Further Details:      
 
Weak hits

Sequence:  mgv1a001279m|PACid:17690476
Domain Number - Region: 718-809
Classification Level Classification E-value
Superfamily Tropomyosin 0.00458
Family Tropomyosin 0.0037
Further Details:      
 
Domain Number - Region: 535-595
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0162
Family Myosin rod fragments 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a001279m|PACid:17690476
Sequence length 847
Sequence
MEKICVAVRVRPSANEESDNGFQWKVESNRISLHRSHGTPISGVSFAFDHVFDQESTNAR
VYELLTKDIIHAAVQGFNGTAFAYGQTSSGKTFTMNGSETDPGVIHRAVKDIFANIQKIS
DREFLIRVSYMEIYNEDINDLFSVENQKLQIHESLERGVFVAGLREEIVNSADQVLNLIQ
LGEANRHFGETNMNARSSRSHTIFRMVIESKAKDNKSNYISSPDDAIRVSVLNLVDLAGS
ERVAKTGAGGVRLKEGKHINKSLMILGNVINKLSEGGKQRGHIPYRDSKLTRILQPALGG
NAKTSIICTVAPEEIHIEETKGTLQFASRAKRITNCVQVNEILTDGALLKRQKQEIEDLR
RKLQGSHAEVLEQEILKLRNDMLKYELEREKLATELEEERRSQKEREQCIKEQQMKIDNL
SNLVPLSDSERSSSHDNVREALLDGSANANSNNTCREDAFSTPCFKAAPNVFVARRSQYI
AQPSCSPLPDMFGDFADEDAWMKMNKGFIADLDSLHMTPSRKVQSFPISEDCSTENHSQE
IQNLQRQLKLVTEERDEFKRKYAEQVSFTNQLAVEISELQEEIQLFQEFPRNLHETVTNC
KDIYKDVFSVLENFVADEKSAAAQILSATSELGNCLFSSLESHLTMALDGKRTSPIIDYS
IRDQCKMLHQKLSGAISSLVLSDASSAIKDDNTDNSVQSSNFKGTLGGQIACWKHSLENE
VKIIKEKYDDMEKELQVSNQLRKVSDGKYNSLEREFHLLKEDRDAVLQRISTSSQKIAQI
TGQKENALKDLNIEVKRRKKLEEEIKQFSVAFACRQRSITSFHSEFKSMLNIMKAQSPNT
LSKSRGS
Download sequence
Identical sequences A0A022R3I4
XP_012841228.1.32330 mgv1a001279m|PACid:17690476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]