SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a001347m|PACid:17675885 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a001347m|PACid:17675885
Domain Number 1 Region: 293-478
Classification Level Classification E-value
Superfamily ARM repeat 1.09e-62
Family MIF4G domain-like 0.0000497
Further Details:      
 
Domain Number 2 Region: 2-296
Classification Level Classification E-value
Superfamily ARM repeat 1.84e-59
Family MIF4G domain-like 0.0000512
Further Details:      
 
Domain Number 3 Region: 478-619,702-734,778-824
Classification Level Classification E-value
Superfamily ARM repeat 4.03e-46
Family MIF4G domain-like 0.001
Further Details:      
 
Weak hits

Sequence:  mgv1a001347m|PACid:17675885
Domain Number - Region: 609-706
Classification Level Classification E-value
Superfamily Tropomyosin 0.053
Family Tropomyosin 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a001347m|PACid:17675885
Sequence length 836
Sequence
MSSWRSLVLRIGEKCAEYGGNADYKDQLETCFGVVRRELLHSGEDILSFLLQCAEQLPHK
IPLYGTLVGLLNLEDEDFVRRIVENTHDNLQVALDTGDNNRVRILMRFLTVLMCSKVLQA
SSLIVLFETLLSSAATTVDEDKGNPSWQACADFYITSILSCLPWGGAELVEQIPEEIDRV
MVGIQAYMSIRRHVSDAGCSPFEFIDDTSQTDGGKDFVEDLWSRIQDLSDKGWKLDSVPR
PHLSFEPQLVAGKSHDIGPLNCPELPDPPASFTGIAYGKQKHEAELKYPHRIRRLNIFPA
SKTEDVQPIDRFVVEEYLLDVLFFLNGCRKECAASMVGLPVSFRYEYLMAETIFSQILLL
PEPPFKPIYYTLVIMDLCKALPGAFPAVVAGAVRSLFDKIADLDMECRTRLILWFSHHLS
NFQFIWPWEEWAYVLDLPKWAPQRVFVQEVLEREVRLSYWEKIKQSIESAPALEELLPPK
GTTNFRYSAEDEDQTEHGLSSELNVMVKERVTSRDIISWIEDQVLPSHGLEVTLRVVVQT
LLNIGSKSFTHLITVLERYGQVIARICSDQDKQVMLISEVSSFWKNSAQMTALSIDRMMG
YRLISNVLRNAVSKTFSRITDLRKEIASLKKSVQSVTEAASKAQAELDDAKSKPTLALVD
GEPVLAENPVKMKRLNSKVEKTKEEEVSTRDSLEAKEALFARAVDEIEALFLFLYKSFSN
VLAAPLQETEGSLHLSGKADEMAIDPEDTSTMELDKEGEISEKSHSNGGKTTKGYNVGEK
EQWCLSTLGYVKALTRQYASEIWPLVEKLDAEVLTEDVHVLLRKAVYSGLGRPTDF
Download sequence
Identical sequences A0A022QJ29
mgv1a001347m|PACid:17675885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]