SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a001479m|PACid:17691317 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a001479m|PACid:17691317
Domain Number 1 Region: 64-212
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000659
Family WD40-repeat 0.029
Further Details:      
 
Weak hits

Sequence:  mgv1a001479m|PACid:17691317
Domain Number - Region: 642-716
Classification Level Classification E-value
Superfamily Tropomyosin 0.000556
Family Tropomyosin 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a001479m|PACid:17691317
Sequence length 811
Sequence
MRFSFDLIEPDSRQSPTPSPSSSTPKADLQWFPLQNHPLFSSATATTTATPAAAERMPPN
LMAWDGTSRLYFWDLNKKCLHRISIRLGEPDPASILAAFPSKVLQAERPTTFEVNKISIN
RNGSALFLSGLEGLRVIYLYGRSSTEENTILCRTVSIGPEIYFDRNNFIRILQISWHPHS
DTHLGILSSDSVFRLFDLSADLGQPEQEYYLQPVEPGSSCNAAAICPVDFSFGGNHLWDR
FSVFILFSDGSSYIICPVVPFGSTYNWESVLEMYNDAHTFGLKSANSKAVYNSNTAISWL
EATFPELVLHSGDGSKLYAVKAQPFVLLDASVSLQGPLRKVSNGATQDSEFEKGVCEGRA
VSFLYNLAGKDSILVTAWSGGQLQLDALADEIQPVWKMGSAPRLRVDSSDQILGVAMICE
SAPNDRSTLKLDHTVWLGHPPPLLRLAIVDLALPTKNSSLIAMINDPLVPERIFCVHMGG
IDLIVLHFLPFTNQTSGKEEAMRTPSVLSVLSTCPDDSSSPSPLHGFLALSDSFGNSWIT
GLTSSKDCIVLQMETWNVLLTDVIDKVREEAVGPDDELKETDVPTIISKELLSGPKSVLL
PPSAPNLRSVTADSIEGRSMLHQYFKLFHENYVEYAHKVYFELQHHAPQLKKVIDNQHSR
LREMQQKLSEVERKKEKIEDRVDRAVERHSSLEERLQNLRKLPGSHKKPLSKAERDFKLE
LDKFSGLELDALHYSIEAVSARLNRHIHSPQAKETQKAGGRRGNSINNRRIEDDNISQLK
SSLAKLSLLNSENSKKVKLVESALKSRDITD
Download sequence
Identical sequences A0A022Q1C4
mgv1a001479m|PACid:17691317 XP_012855492.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]