SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a001520m|PACid:17673339 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a001520m|PACid:17673339
Domain Number - Region: 716-797
Classification Level Classification E-value
Superfamily Tropomyosin 0.000458
Family Tropomyosin 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a001520m|PACid:17673339
Sequence length 804
Sequence
MEDAAQLKPQNQRQLSSHSQRRGGGGVGLPRADFFPEGLLVEVRTKEEGFTRVYFTATVL
PPKKGGSKQKSDKIFVEYHNLLAREDGSERLKEYVDVSFVRPVPPFQEIVEGFEPNDAVD
AFFKDGWWMGAVTRVVKKGESFVVTFEDPPDELELRFEQLRVHWDWGNGLWIRPGNQVIT
GSMFDVGNKVEVSFDKAEYQDVWFPATIRKDFGNGHYSVECIINSDEKAQLCKVKFDHIR
PRPPLLKDIKFLLLEKVDAHFGHGWWCGITTRVLVENSRYMIYFRKKKILKEFNSVELRP
HVEWKDGKWFTASKEVMARSSSSDEQMHGPRASQQDSQNNKSVKKTLRDSVSPISVDISA
ALNAVGDQLPDNPSWGNRIRRKQRNAGATPNNVDEKNKINSASSNTMNKCSMLKPDIPNK
DVGKVTKPIVENDKNEETKHAVVIGLPCSETGSTGNEKSTVKKQKPNGSPIQEIKDNEPL
ENGDSSDKKKRGRPRRGLIANLEIEKGGTTSLPLKRGRRGLTDSPSALGGGEATEVNPNT
MEVEKVVRKSLNDGFDDKPLSKWIKELQPPSAVEYSELVPVSNVEENGKKQSDAIVIEDD
VEMIPESALVAAESQVLPFVKNTVLWTTIESMEAFQKAPQRPHFKPLEQVKESSREGLAI
GYMVTFCGVVERALGLRFDSPKSATDDILETIVDLEMHGFDVKVVRDRVNWLLSVKENEE
KIEVESKKLNDEIAEHDREKSKIEEEMNEIKEQISKLQDKLSLAISATEKEDGEIALLRL
RIKENEESISKARREFEDAVSSKL
Download sequence
Identical sequences A0A022QNB5
mgv1a001520m|PACid:17673339 XP_012846131.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]