SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a001818m|PACid:17686386 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a001818m|PACid:17686386
Domain Number - Region: 481-577
Classification Level Classification E-value
Superfamily Tropomyosin 0.0036
Family Tropomyosin 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a001818m|PACid:17686386
Sequence length 755
Sequence
MASAQVLRKQEHLEAGRKKLEEFRRKKAEEKAKKAISTNQPPASDVPYETQPSETVNPRI
TDFNEVGTSDTLSKDRLGASDLAPKIANKEHETSTKSDFNSSTDTNAKPSLLARKDDGDS
SVLGHTFLNNEEYRDDAASVTSDGHKFQSRKDDYGSAAQFDSEAGNKHFLSHENRAPGHS
TYHGLDNYSSNNIHGSEKDISLGSSATFSSDILPKTSIGALLSEKLGNSRHKDTKISNYM
LFGSSVYSLDRSCWVIESLRPTSNISDSFGLKQKFSSFSDSGEKKFGAVDHMESMSNSSP
WISENRYADYSSDTRSSSNYAPPSPPTSGRRSRPSFLDSIQVSKGPSLSPPLFAAEKADT
SSSKVHPVDGLGSSVSHRSDNITIASGNGVGLFNHVMENKQDFFSQKQNEDFAALEQHIE
DLTQEKFSLQRALEASRALSESLASENSALTDSFNQQGSVVNQLKFELENLQDEIKAQLV
ELEAVKIEYGNAQLECNAADERAKLLASEVIGLEEKALRLRSNELKLERQLENTRAEISS
YKKKMSSIEKDRQDLQSTIDALQEEKKLLLSKLRKASSSGKSTDFNKTTKDISTSTDDID
TDTTTETSALLEDDAPSSQISHENINLSLEGLPMENIPSDQMRMIQNINTLIAELALEKD
QLVQDLSAESSQSSKLLELNKELTRKLEAQTQRLELLMAQSMANANTQPRLVDPRTVPEN
TAYADEGDEVVERVLGWIMKLFPGGPSRRRPGKHL
Download sequence
Identical sequences A0A022RTE7
mgv1a001818m|PACid:17686386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]