SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a001940m|PACid:17676749 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a001940m|PACid:17676749
Domain Number - Region: 121-215
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000942
Family Myosin rod fragments 0.0056
Further Details:      
 
Domain Number - Region: 502-636
Classification Level Classification E-value
Superfamily Tropomyosin 0.00785
Family Tropomyosin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a001940m|PACid:17676749
Sequence length 736
Sequence
MDQKTWLWRKRSSEKSIVAIGEEVQSIPNQKEIDLESTVEALNEELASVLDECSAKQELV
EKYKKTAENAIADKHKADEEIERQKHELHEIRQQRAAESERLFADLNSALKDCMEQLNQS
RKEQDQKIEYAVSEKSREFEKSRNKLEEKIGNLTAESSYLSKALIVKEKIIGDLNRIKNQ
TEGELEVLMKRLDSIEKENAFLRYEFRALEKEVEFGRCSLEASRKKHSENLKKIKKLEGE
CQRLRGLTQKKLPDSSSTVYLPENTRKKMGLLVDQVRDLEKENKKFSSVNSNEVTSSRSW
GASDMSLMDDFVEMEKLAIIAIDSPFVASDSKKPNDWLQNVRDAILEQRNISKKSVEELL
GEIRMDLNSTINIQPISGYITWKSPSSKSTEEWGPHCDLNKSIDEIIEIFGRFNSSHTDE
DEKTIHVFKCKGSEVTRVMQEFIHSCNNLLDGKIDIEKLANYSISFIRWIIENCIISHQG
DFSVREEFEKHLGGAGPGTALELESVQSLMVEMEKKFSTFRVEIEGLNNELNVVKLSNNE
DREIENLIVMNEDLDTRLTVTKAKLDEVVQKLSCVEVELDDKSRSCDELEEKRRELQLQL
ESITSNRRSEDNENREELLQTGLEITKASVIGNQRSSLRDHMQCEDSAEADNLLSPETKE
IIDTIEMNAQSVYPANFSFKNGKEYIGTKSEGINGNAGALVIVPSKKKGGIGFWRKVLLR
RKKANCKNGTSIYFSK
Download sequence
Identical sequences A0A022RFH9
mgv1a001940m|PACid:17676749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]