SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a001948m|PACid:17676329 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a001948m|PACid:17676329
Domain Number 1 Region: 1-262
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.13e-77
Family Motor proteins 0.00000469
Further Details:      
 
Weak hits

Sequence:  mgv1a001948m|PACid:17676329
Domain Number - Region: 423-479
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0188
Family Myosin rod fragments 0.024
Further Details:      
 
Domain Number - Region: 606-694
Classification Level Classification E-value
Superfamily Tropomyosin 0.0562
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a001948m|PACid:17676329
Sequence length 735
Sequence
MNGSETDPGVIHRAVKDIFANIQKISDREFLIRVSYMEIYNEDINDLFPVENQKLQIHES
LERGVFVAELREEIVNSADQVLNLIQLGEANWHFGETNMNARSFVIEIKAKDNKSNYISS
PDDAIHVSVLNLVDLAGSERVAKTGAGGVRLKEGKDINKSLTILGNVINKLSEGGKQRGH
IPYRDSKLTRILQPALGGNAKTSIICTVAPEEIHIEETKGTLQFASRAKRITNCVQVNEI
LTDGALLKRQKQEIEDLRRKLQGSHAKVLEQEILKLRNDMLKYELEREKLAAKLEEERRS
QKEREQCIKEQQMNIDNLSNLVPLSDSERSSSHDGVKQALLDGSANANSNNTCREDAFST
PCFKAAPNVFVARRPLPDMFGDFADEDAWMKMNKGFIADLDSRHMTPSRKVQSFPISEDC
TTENHSQEIQNLQRQLKLVTEERDEFKRKYAEQVSFTNQLAGEISKLQEEIRLFQEFPRN
LHETVTNCKDIYKDVFSVLENFVADEKSASAQILSATRELGNCLFSSLESHLTMAMDGKR
TSPIIDYSIRDQCKMLHQKLSGAISSLVLSDASSAIKDDNTENSVQSSNFKGTLGGQIAC
WKHSLENEVKIIKEKYDDLEKEMEVSNQLRKVSNGKYNSLEREFHLLKEDRDAVLQIIST
SSQKIAQITRQNENALKDLNIEVKRRKKLEEEIKHFSVAFACRQRSITSFHSEFKSMLDI
MMAQSPNTLSKSRGS
Download sequence
Identical sequences A0A022QD49
mgv1a001948m|PACid:17676329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]