SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a002021m|PACid:17695752 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a002021m|PACid:17695752
Domain Number 1 Region: 498-581
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00000000000785
Family Mitotic arrest deficient-like 1, Mad1 0.0039
Further Details:      
 
Weak hits

Sequence:  mgv1a002021m|PACid:17695752
Domain Number - Region: 80-264
Classification Level Classification E-value
Superfamily Tropomyosin 0.0024
Family Tropomyosin 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a002021m|PACid:17695752
Sequence length 725
Sequence
MIIRTPAPRKRRAESEPPEDDNNNNNNTQTPNSNRQQLLIYEDLQAPEYSHGHSTPTTSD
QMLCTYQCRQMVKSEFFDALSSAEKQAHDYQSKFKALNEDFSKSESERKKFRDKCFNAEQ
ELSAAKGREQNLQEQLRKEIDFSQEHLRKQIQSFSELEVKFQKEMDLRKKAELTAAKAED
KASVLEEKLSTVSESIVREKSRLQNELVQMRSESKLSLSRISADLEKMEFRAKNAEKESA
LLKEQLEENKRRMDEFMKEKYEMDKNVSVKSPEASSKDANLLVKHLQEELRNYESEVREA
RKIKAYHEDIELLKEKLYEEKRRRERAELDLVKLSDLQLNVNTLNDELSIWKSVVKEIPG
VLSADDIPSKFAALQREVADSMRRAGEAQACMKEIQVALDTAMLDKQTAETEAALAKEKA
ESSEAEIKRLELMERDRLQNLVKELKERKNVEGGTELAGGTIVQELESSLAKKENYVREL
ENSLSEQKEINSRQHNEIKLLNERLTNEARRLKMLERDGDRLRSEISLLESKLGHGDFSS
ANTKVLRMVNTLAVDNEAKQTIEALQNELQKTKEQLQAVDELKKQSSDAGAHVDSYIAGK
IKQLKEQIAKLEKREERYKTVFAERISVFRRACCELFGYKIVMDDHQRSDGIPVTRFTLN
SIYALSDDEKLQFDYESGNTNIVVNEYTSQREISRQVDIFIRKMNSIPAFTANLTVESFN
KRTLS
Download sequence
Identical sequences A0A022R832
mgv1a002021m|PACid:17695752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]