SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a002193m|PACid:17692745 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a002193m|PACid:17692745
Domain Number - Region: 540-655
Classification Level Classification E-value
Superfamily Tropomyosin 0.0589
Family Tropomyosin 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a002193m|PACid:17692745
Sequence length 703
Sequence
MGSSVTPLHYSVFSKPSSPCVLQPPFLFSSPRNNNNNNGLTRRKNRGSAISCLKQEQNPQ
GDEFCDRRQVMIYMGTFVAIPLLNMRRADAVAENTELSTPNPKQEAEGKSSQNPFLSLLN
SIGFLGSGVLAALYATIKNEKATSDATIESINLKLKEKEAAITFLEKKFETDLSNEKEAR
NKALAKANEEKQSLSNQLGLANGTVKSLGQELQKEKRLIEEKTARIEILENSLNKASNEK
RELQEQLKEKLDSIEVLRERINLLSLEIKDKEDSLRNVNSKFVEKESELTQLSSVYQQAR
DEISRLNLEIEQLKDVIFKKEKEMELNNTELNKLNADLASSRAEIDQYRKKIESLVEEYD
GVALDDVNKNEVLISDLNVEKEDLLEIVKIESKNAKNLEKELEVARESLNESRQEVADLA
KQLQDSRKLCSDLEENISNIRGELSTTKDSLERDIDETKKVVELLAGELKSTKELLIEST
EAAKVKSQELAALVAKCDGLEKELVWAREKEDRTVLELNEEREIVSSLKKDLRVLETRIF
EASEARKRLEEDLEASTKSHDEINRNILNLSKDLEVANSRVFSLEDERDAILRSLEEQKE
VSKEVRENLEDAHSLVMRLGNERENLENRGKKLEEELASAKGEILRLRSEMNSLKSEGSE
RNSQKSEGSEEQMQKIEGGNGKSDAPKKRVTRRRKVTPVQEDS
Download sequence
Identical sequences A0A022Q9Q5
mgv1a002193m|PACid:17692745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]