SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a002202m|PACid:17671857 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a002202m|PACid:17671857
Domain Number 1 Region: 138-375
Classification Level Classification E-value
Superfamily Kelch motif 9.94e-43
Family Kelch motif 0.013
Further Details:      
 
Weak hits

Sequence:  mgv1a002202m|PACid:17671857
Domain Number - Region: 553-666
Classification Level Classification E-value
Superfamily Tropomyosin 0.0177
Family Tropomyosin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a002202m|PACid:17671857
Sequence length 702
Sequence
MFGFSRRKMKIGRVKVQLSDSSQGTRSPIRHAKRFSSSNGEGVALASSESDELNCHSSSN
TPELNNCSSGSSENWMVPSISGEKPTPRFNHAAAVVGNKMVVVGGESASGLLEDVQVLNF
DRYSWTKSSSKLYLSPTSLPLKIPACKGHTLVPWGKKVLLIGGKTEPASDRVSVWAFDME
AECWSLIEAKGDIPVARSGHTVVRANSVLILFGGEDSKRRKLNDLHMFDLKSLTWLPLHC
TGPRPSPRSNHIAALYNDKMLFVFGGASKSRTLNDLYSLDFEAMVWSRIKIRGFHPSPRS
GCCGALCGTKWYITGGGSKRKRPAETLIFDVIKFEWSIAVASHPSSITTNKGFSLVLVQH
KERDILVAFGGIKKDPSNQVEVLIMEKVESSIIRRSTLSKVAGTLLSENGPSSIGLSQPG
NAASLSGHFDSISRLNLASAIEHHGSGRKSLSESLLVDPNPGPGNVSLRKQFYNEEENAD
ATTTKISVDKNSFQTMEPNTKLSDSGGVGVSYNGDRSTEERSYASESDKQETEDLILQEN
DGKSRMTAPPGVYQVSEAKLASLMRKNGILEGQLAAALAAREAAEKNLSAAIRSRLEMEK
KLGEAMKEMEMLREKVTSVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHS
TRGVLAGEHGRAFQLQVEVFHLKQRLQSLEPRAPTPRKPYHV
Download sequence
Identical sequences A0A022RY49
mgv1a002202m|PACid:17671857 XP_012858905.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]