SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a002339m|PACid:17684184 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a002339m|PACid:17684184
Domain Number 1 Region: 43-138
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000029
Family BTB/POZ domain 0.01
Further Details:      
 
Weak hits

Sequence:  mgv1a002339m|PACid:17684184
Domain Number - Region: 595-640
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0497
Family Myosin rod fragments 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a002339m|PACid:17684184
Sequence length 686
Sequence
MWDSETESVGGGRDYCNGGGGGGGLSSTNKPRVETDGFEQRGQSWYVATDIPSDLSVQIQ
DVGFHLHKYPLLSRSGKMNRVIYESREIELNKVALDDLPGGPEAFELAAKFCYGVAVDLS
ATNISGLRCAAEYLEMTEDLEEGNLIFKTEAFLSYVVLSSWRDSIVVLKSCEKLSPWAEN
LQIVRRCSESIAWKACANPKGIKWQYTGRPARSVSSPKWNDMKDSSPSRNGTPVPSDWWF
EDVSILRIDHFVRVITAIKVKGMRYELIGAAITHYANKWLPNLAKDGGDGGGDGVGGGGD
SWQKGGGLHMIIAAGNNKDESFLPAAMQAKDQRMIVESLISIIPPQRDCVSCSFLLRLLK
TANMSKVAPALVTELEKRVGMQLEQAALADLLIPCYSKSEGLMYDVDLVQRLLEHFLVQE
QTEGSSPSRQSFSEMKMYDGAQRGVNLSAKLRVARLLDGYLTEVSRDRNLSLTKFQVLAE
ALPESSRSCHDGLYRAVDSYLKAHPTLTEHERKRLCRVMDCQKLSIDACMHAAQNERLPL
RIVVQVLFSEQVKISNAIANTSLKDDGESHYQPLVSNRKTLLEGTPQSFQEGWASAKKDI
NTLKFELESVKAKYSELQNDMDTLQRQFDKITKVKQTTTSSGSAWSSGWKKLSKLTKVTE
TNDVGSHVANADVIKKAPRRWRNSIS
Download sequence
Identical sequences A0A022PQ59
mgv1a002339m|PACid:17684184 XP_012828325.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]