SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a002725m|PACid:17686063 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a002725m|PACid:17686063
Domain Number 1 Region: 77-165,200-634
Classification Level Classification E-value
Superfamily Cullin repeat-like 4.08e-161
Family Exocyst complex component 0.001
Further Details:      
 
Weak hits

Sequence:  mgv1a002725m|PACid:17686063
Domain Number - Region: 8-110
Classification Level Classification E-value
Superfamily Tropomyosin 0.00105
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a002725m|PACid:17686063
Sequence length 643
Sequence
MVAHAAAMETLSERAALMRESMQKTQSITDSMVAILGSFDHRLSALETAMRPTQLRTHSI
RRAHENIDKTLKAAEAILNQFDRSRQAEAKILRGPHEDLESYLEAVDQLRSIVRFFSGNK
GFKSSIMVVNQANNLLGKAISKLEEEFRQLLNAYSKPVEPDRLFDCLPNSMRPSAGSPRD
GESNGKKQSEHQNKSLEPVVYQLPTLIPPRILPLLHDMTQQMIQAGHQLQIATIYRDARA
SAVEQTLRKLGVERLGKEDVQKMQWEVLEAKIGNWIHFMRIAVKLLFAGEKKVCDEIFEG
HENLGEQCFAEVTANSVTMLLSFGEAIAKSKRSPEKLFVLLDMYEIMRELQTEIDIIFAS
KYCGEMREASLVLSKRLAQTAQETFGDFEEAVEKDATKTAVLDGTVHPLTSYVINYVKFL
FDYHSTLQQLFKEFDDGDAEKQLASITTRIMQALQSNLDGKSKQYKDPALTQLFLMNNIH
YIVRSVRRSEAKDLLGDDWVQIHRRVVQQHANQYKRIAWSKILQCLSIQGAQSGGSGSFG
DGGSTAGVSRAMVKDRFKNFNMLFEEIHQRQSQWTVPDSELRESLRLAVAEVLLPAYRSF
IRRFGPMIEGGKNPQKYIRYSPEDLERMLAEFFEGKTWNEPRR
Download sequence
Identical sequences A0A022PUD2
mgv1a002725m|PACid:17686063 XP_012827264.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]