SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a002784m|PACid:17685027 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a002784m|PACid:17685027
Domain Number 1 Region: 350-401,460-623
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000019
Family ABC transporter ATPase domain-like 0.0059
Further Details:      
 
Domain Number 2 Region: 34-174
Classification Level Classification E-value
Superfamily Smc hinge domain 0.000000759
Family Smc hinge domain 0.019
Further Details:      
 
Weak hits

Sequence:  mgv1a002784m|PACid:17685027
Domain Number - Region: 220-285
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0366
Family Myosin rod fragments 0.011
Further Details:      
 
Domain Number - Region: 298-423
Classification Level Classification E-value
Superfamily t-snare proteins 0.0549
Family t-snare proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a002784m|PACid:17685027
Sequence length 638
Sequence
MGLHVKSLEQQIHDLHEQYMKNTQVTAFGGSLVTSLLQAIERHQHKFSSPPIGPIGTHVK
LEHGDMWSIAVENAVGRVLNAFIVTDHKDARILRACAREANYNHLQIIIYDFSRPRLDIP
RHMLPQTNHPTAFSVIHSDNPTVLNVLVDVASAERQVLVKDYDVGKTVAFDQRVSNLKEV
YTSDGFKMYCRSGFSRGSAQTILPPNKNFRAGRLCGSFDNEIKNLERDALEVKERAQQGR
GVKRAKEEELRNLHSMLSSVKRRRIDVERQSKKMEFELADVKKLLSSEVSSGPASTVDEL
HEDISKVQNEIREKETLLEKLHQRVAEAGIKAKDLKVSFENLCESAKSEIDALAEAEREL
MMIEKDLHAAEREKKHYEEIMHKKVLSELQNAKAEFQELERICKENNRKASMICPEDEIE
ALGGCKESPEQLSTLLGRATQRLERESQRFPESIDDLRMLCEKKERKISRKQQTYKAFRE
KLEACEVALHFRWKKFQSNANALKRQLTWQFNGHLVKKGISGKIKVSYEEQTLSVEVNMP
QDASSSSVCDTRGLSGGERSFSTLCFALALHEMTESPFRAMDEFDVFMDAVSRKISLDAL
VDFALAQGSQWIFITPHDISMVKHDERIKKQQMAAPRG
Download sequence
Identical sequences A0A022QAJ9
mgv1a002784m|PACid:17685027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]