SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a002984m|PACid:17685717 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a002984m|PACid:17685717
Domain Number - Region: 234-304
Classification Level Classification E-value
Superfamily Tropomyosin 0.00307
Family Tropomyosin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a002984m|PACid:17685717
Sequence length 619
Sequence
MAVEVVKSNMVIVDNGSAANESMDNEKVNIKFGSHGVEEPAKGEANSVSAPNNLPTDAVD
EWPEPKQIHSFYIVRYRALEDHNLKAKLDLADKELQKKNQARFQIIEKLRAKRGDRGQVL
AEIRSLSVENRQFRTIIDEKRKEMEPLQQALGKLRGNSSGGGREKGSGIICSSEAELNNL
IKSLEYRIQHESIPLSEEKQIMREIKQLEGTRDKVIVFAAERAKIQDSMGEKVDIQGQVK
SIGVDLDGVRKDKQVVNAKLKQLDEAKAAIEKEINALEAELNAVSEKRDSTFETIRSMRK
QREEGNTPFYQNRMVLTKAKALASDKDVGALKEHSDTEVENFMSLWNSNKSFRVDYESRI
LQSLDQRQLSKDGRLRNPNEKPLLQPETPPAAAAAPRNEIVAKQTPKEVAVAPTTEAVVV
VDPTSEQKVEKAKGAKGGNKKTRVDEQEEEEELFFVTKKDSLPKKTEVDEAKLKEIKREE
EIAKRIQAEERKKKMAEKAAAKAAIKAEKEAEKKLKEREKKAKKKSGGGAVTAADSEEAV
AEVAEPQKIEEEIEIPAPTEKVKDRKGSSTVRARARPRGQDTITKTILKRKKGTNYWVWA
APAATVVVLVLVVVAKSYL
Download sequence
Identical sequences A0A022RZ54
XP_012847781.1.32330 mgv1a002984m|PACid:17685717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]