SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a002994m|PACid:17678435 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a002994m|PACid:17678435
Domain Number - Region: 88-199
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0366
Family beta-sandwich domain of Sec23/24 0.027
Further Details:      
 
Domain Number - Region: 279-381
Classification Level Classification E-value
Superfamily Tropomyosin 0.0418
Family Tropomyosin 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a002994m|PACid:17678435
Sequence length 618
Sequence
MASPLHRHTRSSSSGLSNMKKPQNAKAAAQRLAQVMAHQPADDEDEEDDLLYDFAPAVSS
GGIGLAGGRQNKNRSPRSVRSSVDQPPPPSSRPSSVARPSSSYNLSEQQQQPLSARTTTS
LLRPTPPQPKPPEPSTHLPPSSISVRSSQPVELSPHHQHSSSSIPFRSSQPVAVEVSPHF
HSSSGSARSTQHADPADESQSPQHGRSSASGRSPSFSEQPTSARFGSVGRPNLKVKTAAI
VPPAVPLSIKPVLSADSLQEKTRDKRLSLDFGTFKYKEPSGQQSSSALQDELDMLQEEND
SLVEKLRLVEERCEEAESRTRQLEKQIASLGEGVSLEARLLSRQAAREEATSAMEQLHDV
EREVKSLQIVTQRMILTQEEMEEVVLKRCWLARCWSLCVKHGIHAEIAGARYDYWSSFAS
TPVEVILAAGKKAKLENSSLNSDLEVREKVLQAKDQVPKMVNVESMLMVEKGLRELTSLK
VEEAIAISMARKRRPSIVKSNVLDDLKLPIEGPNFSEAYELSSEETEDVLLKQAWLLYFW
RRAKNQGLEADIAEERLQLWINQWNKQPTSHDAVDVERGLMELRKLGVETKLWEEPRRLV
DQESSHKTLLETEYQMLA
Download sequence
Identical sequences A0A022RH36
mgv1a002994m|PACid:17678435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]