SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mgv1a003084m|PACid:17684264 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a003084m|PACid:17684264
Domain Number 1 Region: 50-143
Classification Level Classification E-value
Superfamily POZ domain 5.26e-17
Family BTB/POZ domain 0.008
Further Details:      
 
Weak hits

Sequence:  mgv1a003084m|PACid:17684264
Domain Number - Region: 511-569
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00575
Family Myosin rod fragments 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a003084m|PACid:17684264
Sequence length 609
Sequence
MMKLSVQPQSPASDSDEIYQADDQRIAIPARFNATTDSFEKNEHSCRKIMSQVPTDLSIQ
VQDVTFYVHKYPLISRCGYFSRVEFQFPKSNLNCDIELDNLPGGPETFETILKFCYDIPI
NLKVNTVAALRCASEYLEMTEALEDGNLISKTEAFFTFVVLSSWGGSITVLKSCESLSPW
AENLQIVRRCCDSIAWKISQEASEVINGEKNWWFEEMSTLRIDYFTRIVTGLRARGSKPE
IIGSCIVHYGERWLPEGRGNELQWNITGGAIREEDSRPIREQRIIVESLVSLLPSEKEAV
SCKFLLKMLKMAILYSASPALVAELEKRTGLVLETADVNDLLIPSYTAGNKIKLISSTEE
NIMHNVDVVQRILEYFLLYEQQQQQQLLPGPLAVSKLLDNYLAEIAKDPNLPVTKFQFLA
QSLPENARKSDDGLYRAIDTYLKTHPSLSDHDRRRLCKVMNCGKLSVDACAHAAQNDRLP
LRTMIQVLFAEQMKIRATVQGKSQTEIADNSDQESSWLSTNKEVKALKLELEKVKSQMAE
MQRDHSDLQQERQKQNIKQGNSSGWTIRWQRIRKSALFNLKTDGEETDEVNKRPNNIGKG
SFRRRQSLS
Download sequence
Identical sequences A0A022QWW7
mgv1a003084m|PACid:17684264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]